A CLI and Python library to interact with Azulene Opal
Project description
Opal Quick Start Guide:
This guide walks you through a complete working example of using Opal to submit and monitor an Absolute Binding Free Energy job using a protein and ligand file.
You will learn how to:
a. Install azulene-opal from PyPI
b. Log in
c. Place your protein + ligand files in the correct location
d. Submit an absolute_binding job (including automatic file upload)
e. Check job status and retrieve results
Create and activate a virtual environment (optional)
For conda
conda create -n opal-env python=3.11 -y
conda activate opal-env
For Python
# Create a virtual environment
python -m venv opal-env
# Activate the environment on Windows
opal-env\Scripts\activate
# Activate the environment on macOS / Linux
source opal-env/bin/activate
a. Install azulene-opal from PyPI
pip install azulene-opal
Confirm installation:
python -m opal.main --help
b. Log in
Run:
python -m opal.main login
The CLI will securely prompt you:
Your email: example@gmail.com
Your password: **********
After this, Opal stores your auth tokens locally so you don’t need to log in again.
c. Place your protein and ligand files
For this example, we place the files in a folder named examples:
examples/
t4_lysozyme.pdb
toluene.sdf
The file paths will be:
examples/t4_lysozyme.pdbexamples/toluene.sdf
The CLI will automatically detect these as local files, upload them to Opal, and replace the paths with storage URLs.
d. Submit an absolute_binding job
The job type is:
absolute_binding
The required parameters are:
{
"pdb_file": "",
"ligand_file": ""
}
Example 1: Using the sample files
from opal import jobs
result = jobs.submit(
job_type="absolute_binding",
input_data={
"pdb_file": "./examples/data/t4_lysozyme.pdb",
"ligand_file": "./examples/data/toluene.sdf"
}
)
print(result)
You should see something like:
📤 Uploading local files...
✅ Job submitted successfully
{
"job_id": "xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx",
"status": "submitted",
"message": "Job submitted successfully"
}
Example 2: Absolute Binding Free Energy (Ligand Already in PDB)
This example runs an absolute_binding job using:
- A protein PDB file
- A ligand inside the PDB file
- A SMILES string for the ligand
- Shortened equilibration & production lengths
- Only 1 protocol repeat
from opal import auth, jobs
# 1. Log in (Only if you haven't logged in)
auth.login(email="your@email.com", password="yourpassword")
# 2. Submit the job
input_data = {
"pdb_file": "./examples/data/fkb_model_0_2.pdb",
"ligand_smiles": "CS(=O)C",
"protocol_repeats": 1,
"ligand_in_pdb_file": True,
"complex_prod_length": 0.1,
"solvent_prod_length": 0.1,
"complex_equil_length": 0.02,
"solvent_equil_length": 0.02
}
result = jobs.submit(
job_type="absolute_binding",
input_data=input_data
)
print(result)
e. Submit an Absolute Aqueous Solvation Free Energy job
The job type is:
aqueous_solvation
The required parameters are:
{
"smiles": ""
}
Example: Using a simple SMILES (CCO)
from opal import jobs
result = jobs.submit(
job_type="aqueous_solvation",
input_data={
"smiles": "CCO"
}
)
print(result)
You should see something like:
✅ Job submitted successfully
{
"job_id": "xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx",
"status": "submitted",
"message": "Job submitted successfully"
}
f. Other useful commands
1. List your jobs
Last 5 jobs (default):
python -m opal.main jobs get-jobs
All jobs:
python -m opal.main jobs get-jobs --all
Filter by job type and status:
python -m opal.main jobs get-jobs \
--job-type absolute_binding \
--status completed
Filter by date:
python -m opal.main jobs get-jobs \
--start-date 2025-12-01T00:00:00Z \
--end-date 2025-12-05T00:00:00Z
2. Check a specific job
python -m opal.main jobs get --job-id YOUR_JOB_ID
This returns:
- job status
- input data
- results (if completed)
- timestamps
- any error messages
3. Poll running jobs
python -m opal.main jobs check-running-jobs
Use this to check on running jobs.
4. Cancel a job
python -m opal.main jobs cancel --job-id YOUR_JOB_ID
Only works if the job is still running.
Azulene-Opal
This guide shows how to:
- Log in
- Submit a job
- Inspect and filter jobs
- Get / cancel a specific job
- Poll running jobs
- Check service health & job types
- Submit a batch of jobs
How to download OPAL
pip install azulene-opal
0. Imports (Python)
from opal import auth, jobs
1. Log in
from opal import auth
res = auth.login(email="test@example.com", password="pass123")
print(res) # {"ok": True, "message": "Logged in successfully!"}
You stay logged in via locally stored tokens until you explicitly log out.
2. Check who you are
from opal import auth
res = auth.whoami()
print(res)
# {
# "ok": True,
# "user": { ... full user object ... },
# "slim": {
# "email": "...",
# "role": "...",
# "approved": True,
# ...
# }
# }
3. Submit a single job
Example job type: generate_conformers with a SMILES and number of conformers.
from opal import jobs
res = jobs.submit(
job_type="generate_conformers",
input_data={"smiles": "CCO", "num_conformers": 5}, # dict
)
print(res)
# {"ok": True, "data": {"job_id": "...", "status": "submitted", ...}}
(You can also pass a JSON string instead of a dict if you want.)
4. List and filter jobs
By default, the server returns the last 5 jobs for the current user. You can ask for all jobs, limit, or filter by job_type, status, or date range.
from opal import jobs
# Last 5 jobs (default)
print(jobs.get_jobs())
# All jobs
print(jobs.get_jobs(all_jobs=True))
# Last 10 jobs
print(jobs.get_jobs(limit=10))
# Filter by job_type and status
print(
jobs.get_jobs(
job_type="generate_conformers",
status="completed",
)
)
# Filter by created_at date range (ISO timestamps)
print(
jobs.get_jobs(
start_date="2025-12-01T00:00:00Z",
end_date="2025-12-05T00:00:00Z",
)
)
Each call returns something like:
{"ok": True, "data": [ { "id": "...", "job_type": "...", ... }, ... ]}
5. Get a specific job
Once you have a job_id, you can fetch that job’s details.
from opal import jobs
res = jobs.get(job_id="YOUR_JOB_ID")
print(res)
# {"ok": True, "data": { "id": "...", "status": "...", "input_data": {...}, "results": {...}, ... }}
6. Cancel a job
If a job is still running, you can cancel it.
from opal import jobs
res = jobs.cancel(job_id="YOUR_JOB_ID")
print(res)
# {"ok": True, "data": {...}}
7. Poll running jobs
This endpoint checks any currently running jobs and update their statuses.
from opal import jobs
res = jobs.check_running_jobs()
print(res)
# {"ok": True, "data": {...}} # depends on your backend payload
8. Health check
Check that the Opal backend is reachable.
from opal import jobs
res = jobs.check_health()
print(res)
# {"ok": True, "data": {...}} on success
9. Discover available job types
List job types supported by the current backend.
from opal import jobs
res = jobs.get_job_types()
print(res)
# {"ok": True, "data": ["generate_conformers", "absolute_solvation_energy_aqueous", ...]}
10. Submit a batch of jobs (same job_type, many inputs)
You can submit multiple jobs at once for a single job_type.
Each entry in the list becomes a separate job under the hood.
from opal import jobs
small_input_list = [
{"smiles": "CCO", "num_conformers": 5},
{"smiles": "CCCO", "num_conformers": 3},
{"smiles": "CCcndO","num_conformers": 2},
]
res = jobs.submit_batch_jobs(
job_type="generate_conformers",
input_data=small_input_list,
)
print(res)
# {
# "ok": True,
# "results": [
# {
# "index": 0,
# "input": {...},
# "response": {
# "ok": True,
# "data": {
# "job_id": "...",
# "status": "submitted",
# "message": "Job submitted successfully",
# ...
# }
# }
# },
# ...
# ]
# }
11. Log out
When you’re done, you can clear the local tokens.
from opal import auth
res = auth.logout()
print(res) # {"ok": True}
TL;DR minimal workflows
from opal import auth, jobs
# 1) Log in
auth.login(email="test@example.com", password="pass123")
# 2) Submit a job
submit_res = jobs.submit(
job_type="generate_conformers",
input_data={"smiles": "CCO", "num_conformers": 5},
)
print(submit_res)
# 3) List recent jobs
print(jobs.get_jobs())
# 4) Fetch that job by ID
job_id = submit_res["data"]["job_id"]
print(jobs.get(job_id=job_id))
Help Commands
python -m opal.main --help
python -m opal.main jobs --help
python -m opal.main jobs submit --help
Opal Job Types:
This document lists all currently available Opal job types, their purpose, required inputs, and example payloads.
You can fetch this list via:
python -m opal.main jobs get-job-types
or in Python:
from opal import jobs
jobs.get_job_types()
Overview
| ID | Name | Description |
|---|---|---|
generate_conformers |
Generate Conformers | Generate molecular conformers from SMILES notation |
mp2 |
MP2 Calculation | Møller–Plesset second-order perturbation theory |
hartree_fock |
Hartree-Fock Calculation | Self-consistent field Hartree–Fock calculation |
ccsd_calculation |
CCSD Calculation | Coupled Cluster Singles and Doubles |
xtb_calculation |
XTB Calculation | Extended tight-binding semi-empirical calculation |
molecular_dynamics |
Molecular Dynamics | Molecular dynamics simulation |
aqueous_solvation |
Absolute Aqueous Solvation Free Energy | Solvation free energy in water |
relative_fe |
Relative Free Energy | Relative free energy between two molecules in water |
relative_fe_uaa |
Relative Free Energy for (Unnatural) Amino Acids | Relative FE between two (un)natural amino acid structures |
nonaqueous_solvation |
Absolute Nonaqueous Solvation Free Energy | Solvation FE of a solute between two solvents |
reaction_free_energy |
Aqueous Reaction Free Energy | Reaction free energy in aqueous solution |
deprotonation_fe |
Deprotonation Free Energy | Deprotonation free energy in aqueous solution |
absolute_binding |
Absolute Binding Free Energy | Binding FE of a ligand to a protein in water |
relative_binding |
Relative Binding Free Energy | Relative binding FE between two ligands |
relative_binding_uaa |
Relative Binding FE for (Unnatural) Amino Acids | Relative binding FE for (un)natural amino acid ligands |
lipid_permeation |
Lipid Permeation Free Energy | FE of permeation through a lipid bilayer |
pocket_docking |
Pocket Finding and Ligand Docking | Pocket finding + docking of a ligand to a protein |
upload_file |
Upload File | Uploads a file and returns its storage path |
boltz_prediction |
Boltz-2 Affinity and Structure Prediction | Protein–ligand affinity + structure prediction using Boltz-2 |
1. Generate Conformers (generate_conformers)
Description: Generate molecular conformers from SMILES notation.
Input Schema
| Field | Type | Required | Default | Description |
|---|---|---|---|---|
smiles |
string | yes | — | SMILES of the molecule |
num_conformers |
number | yes | 5 |
Number of conformers to generate |
Example Input
{
"smiles": "CCO",
"num_conformers": 5
}
2. MP2 Calculation (mp2)
Description: Møller–Plesset second-order perturbation theory.
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
atom |
string | yes | Atomic coordinates in XYZ format |
basis |
string | yes | Basis set for the calculation |
Example Input
{
"atom": "H 0 0 0; H 0 0 0.74",
"basis": "ccpvdz"
}
3. Hartree-Fock Calculation (hartree_fock)
Description: Self-consistent field Hartree–Fock calculation.
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
atom |
string | yes | Atomic coordinates in XYZ format |
basis |
string | yes | Basis set for the calculation |
Example Input
{
"atom": "H 0 0 0; F 0 0 1.1",
"basis": "ccpvdz"
}
4. CCSD Calculation (ccsd_calculation)
Description: Coupled Cluster Singles and Doubles calculation.
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
atom |
string | yes | Atomic coordinates in XYZ format |
basis |
string | yes | Basis set for the calculation |
Example Input
{
"atom": "H 0 0 0; H 0 0 0.74",
"basis": "ccpvdz"
}
5. XTB Calculation (xtb_calculation)
Description: Extended tight-binding semi-empirical calculation.
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
numbers |
array | yes | Atomic numbers of the atoms |
positions |
array | yes | 3D coordinates of the atoms |
Example Input
{
"numbers": [8, 1, 1],
"positions": [
[0, 0, 0],
[0.96, 0, 0],
[-0.24, 0.93, 0]
]
}
6. Molecular Dynamics (molecular_dynamics)
Description: Molecular dynamics simulation.
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
numbers |
array | yes | Atomic numbers |
positions |
array | yes | Initial 3D coordinates |
Example Input
{
"numbers": [1, 1],
"positions": [
[0, 0, 0],
[0.74, 0, 0]
]
}
7. Absolute Aqueous Solvation Free Energy (aqueous_solvation)
Description: Absolute solvation free energy of a molecule in water via alchemical transformations.
Key Input Fields
| Field | Type | Required | Default | Description |
|---|---|---|---|---|
smiles |
string | yes | — | Solute SMILES |
protonate |
boolean | no | false |
Protonate at given pH |
ph |
number | no | 7 |
pH for protonation |
solvent_equil_length |
number | no | 0.08 |
Solvent equilibration length (ns / replica) |
solvent_prod_length |
number | no | 0.4 |
Solvent production length (ns / replica) |
vacuum_equil_length |
number | no | 0.08 |
Vacuum equilibration length (ns / replica) |
vacuum_prod_length |
number | no | 0.4 |
Vacuum production length (ns / replica) |
platform |
string | no | CUDA |
OpenMM platform (CUDA, OpenCL, CPU, Reference) |
protocol_repeats |
integer | no | 3 |
# of repeats for uncertainty |
keep_dirs |
boolean | no | True |
Keep working directories |
Example Input
{
"smiles": "CCO"
}
8. Relative Free Energy (relative_fe)
Description: Relative FE between two molecules in water.
Key Input Fields
| Field | Type | Required | Default | Description |
|---|---|---|---|---|
smiles_a |
string | yes | — | SMILES of molecule A |
smiles_b |
string | yes | — | SMILES of molecule B |
protonate |
boolean | no | false |
Protonate at pH |
ph |
number | no | 7 |
pH value |
equil_length |
number | no | 0.08 |
Equilibration length (ns / replica) |
prod_length |
number | no | 0.4 |
Production length (ns / replica) |
platform |
string | no | CUDA |
OpenMM platform |
protocol_repeats |
integer | no | 3 |
# of repeats |
keep_dirs |
boolean | no | True |
Keep working dirs |
Example Input
{
"smiles_a": "CCO",
"smiles_b": "CCC"
}
9. Relative Free Energy for (Unnatural) Amino Acids (relative_fe_uaa)
Description: Relative FE between two (un)natural amino acid sequences.
Key Input Fields
| Field | Type | Required | Default | Description |
|---|---|---|---|---|
sequence_a |
string | yes | — | First peptide sequence (standard codes or UAA notation) |
sequence_b |
string | yes | — | Second peptide sequence |
uaa_map |
object | no | — | Map of placeholders (e.g. {"x": "pF-Phe"}) |
protonate |
boolean | no | false |
Protonate at pH |
ph |
number | no | 7 |
pH value |
equil_length |
number | no | 0.08 |
Equilibration length (ns / replica) |
prod_length |
number | no | 0.4 |
Production length (ns / replica) |
platform |
string | no | CUDA |
OpenMM platform |
protocol_repeats |
integer | no | 3 |
# of repeats |
keep_dirs |
boolean | no | True |
Keep working dirs |
Example Input
{
"sequence_a": "YGH",
"sequence_b": "<pF-Phe>GH"
}
10. Absolute Nonaqueous Solvation Free Energy (nonaqueous_solvation)
Description: Solvation FE of a solute between two solvents.
Key Input Fields
| Field | Type | Required | Default | Description |
|---|---|---|---|---|
smiles_solute |
string | yes | — | Solute SMILES |
smiles_solvent_a |
string | yes | — | Solvent A SMILES ("None" for vacuum) |
smiles_solvent_b |
string | yes | — | Solvent B SMILES ("None" for vacuum) |
equil_length |
number | no | 0.08 |
Equilibration length (ns / replica) |
prod_length |
number | no | 0.4 |
Production length (ns / replica) |
platform |
string | no | CUDA |
OpenMM platform |
Example Input
{
"smiles_solute": "CCO",
"smiles_solvent_a": "None",
"smiles_solvent_b": "O"
}
11. Aqueous Reaction Free Energy (reaction_free_energy)
Description: Reaction free energy in aqueous solution.
Key Input Fields
| Field | Type | Required | Description |
|---|---|---|---|
smiles_reactant |
string | yes | Reactants SMILES (comma-separated) |
smiles_product |
string | yes | Products SMILES (comma-separated) |
stoichiometry_reactant |
string | yes | Stoichiometry of reactants (comma-separated) |
stoichiometry_product |
string | yes | Stoichiometry of products (comma-separated) |
solvent_equil_length |
number | no | Solvent equilibration length |
solvent_prod_length |
number | no | Solvent production length |
vacuum_equil_length |
number | no | Vacuum equilibration length |
vacuum_prod_length |
number | no | Vacuum production length |
platform |
string | no | OpenMM platform |
protocol_repeats |
integer | no | # of repeats |
use_xtb |
boolean | no | Use xTB for gas-phase |
keep_dirs |
boolean | no | Keep dirs |
Example Input
{
"smiles_reactant": "C(=O)=O,O",
"smiles_product": "OC(=O)O",
"stoichiometry_reactant": "1,1",
"stoichiometry_product": "1",
"use_xtb": true
}
12. Deprotonation Free Energy (deprotonation_fe)
Description: Deprotonation free energy in aqueous solution.
Key Input Fields
| Field | Type | Required | Description |
|---|---|---|---|
smiles_prot |
string | yes | SMILES of protonated species |
smiles_deprot |
string | yes | SMILES of deprotonated species |
solvent_equil_length |
number | no | Solvent equilibration |
solvent_prod_length |
number | no | Solvent production |
vacuum_equil_length |
number | no | Vacuum equilibration |
vacuum_prod_length |
number | no | Vacuum production |
platform |
string | no | OpenMM platform |
protocol_repeats |
integer | no | # of repeats |
use_xtb |
boolean | no | Use xTB |
keep_dirs |
boolean | no | Keep dirs |
Example Input
{
"smiles_prot": "C(=O)O",
"smiles_deprot": "C(=O)[O-]",
"use_xtb": true
}
13. Absolute Binding Free Energy (absolute_binding)
Description: Absolute binding FE of a ligand to a protein in water.
Key Input Fields
| Field | Type | Required | Description |
|---|---|---|---|
pdb_file |
file | yes | Protein PDB (may optionally contain ligand) |
ligand_file |
file | no | Ligand file (SDF, PDB, or CIF format) |
ligand_in_pdb_file |
boolean | no | Whether ligand is in protein PDB |
ligand_smiles |
string | no | Ligand SMILES (esp. if ligand is only in PDB) |
solvent_equil_length |
number | no | Ligand solvent equilibration |
solvent_prod_length |
number | no | Ligand solvent production |
complex_equil_length |
number | no | Complex equilibration |
complex_prod_length |
number | no | Complex production |
platform |
string | no | OpenMM platform |
protocol_repeats |
integer | no | # of repeats |
keep_dirs |
boolean | no | Keep dirs |
Example Input
{
"pdb_file": "examples/t4_lysozyme.pdb",
"ligand_file": "examples/toluene.sdf"
}
14. Relative Binding Free Energy (relative_binding)
Description: Relative binding FE between two ligands to the same protein.
Key Input Fields
| Field | Type | Required | Description |
|---|---|---|---|
pdb_file |
file | yes | Protein PDB |
ligand_file_a |
file | no | First ligand file (SDF, PDB, or CIF format) |
ligand_file_b |
file | no | Second ligand file (SDF, PDB, or CIF format) |
ligand_in_pdb_file_a |
boolean | no | First ligand in protein PDB |
ligand_in_pdb_file_b |
boolean | no | Second ligand in protein PDB |
smiles_a |
string | no | SMILES of ligand A |
smiles_b |
string | no | SMILES of ligand B |
protonate |
boolean | no | Protonate |
ph |
number | no | pH value |
equil_length |
number | no | Equilibration length |
prod_length |
number | no | Production length |
platform |
string | no | OpenMM platform |
protocol_repeats |
integer | no | # of repeats |
keep_dirs |
boolean | no | Keep dirs |
Example Input
{
"pdb_file": "protein.pdb",
"ligand_file_a": "ligandA.sdf",
"ligand_file_b": "ligandB.sdf"
}
15. Relative Binding FE for (Unnatural) Amino Acids (relative_binding_uaa)
Description: Relative binding FE between two (un)natural amino acid ligands.
Key Input Fields
| Field | Type | Required | Description |
|---|---|---|---|
sequence_a |
string | yes | First peptide sequence |
sequence_b |
string | yes | Second peptide sequence |
pdb_file |
file | yes | PDB file (e.g. from previous job) |
uaa_map |
object | no | Map placeholders to UAA names/SMILES |
protonate |
boolean | no | Protonate |
ph |
number | no | pH value |
equil_length |
number | no | Equilibration |
prod_length |
number | no | Production |
platform |
string | no | OpenMM platform |
protocol_repeats |
integer | no | # of repeats |
keep_dirs |
boolean | no | Keep dirs |
Example Input
{
"sequence_a": "YGH",
"sequence_b": "xGH",
"pdb_file": "protein.pdb",
"uaa_map": "{\"x\": \"pF-Phe\"}"
}
16. Lipid Permeation Free Energy (lipid_permeation)
Description: Free energy of a molecule permeating through a lipid bilayer.
Key Input Fields
| Field | Type | Required | Description |
|---|---|---|---|
smiles |
string | yes | Solute SMILES |
lipid_type |
string | yes | Lipid type (DPPC, DMPC, DOPC, DLPE, DLPC, POPE, POPC) |
equil_length |
number | no | Equilibration length |
prod_length |
number | no | Production length |
platform |
string | no | OpenMM platform |
keep_dirs |
boolean | no | Keep dirs |
Example Input
{
"smiles": "O",
"lipid_type": "POPC"
}
17. Pocket Finding and Ligand Docking (pocket_docking)
Description: Find the binding pocket and dock a ligand to a protein.
Key Input Fields
| Field | Type | Required | Description |
|---|---|---|---|
pdb_file |
file | yes | Protein PDB |
ligand_smiles |
string | yes | Ligand SMILES |
ph |
float | no | pH value (default: 7) |
Example Input
{
"pdb_file": "protein.pdb",
"ligand_smiles": "CC1=CC=CC=C1"
}
18. Upload File (upload_file)
Description: Uploads a file and returns its storage path.
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
file_path |
file | yes | Local file path to upload |
Example Input
{
"file_path": "examples/input.txt"
}
19. Boltz-2 Affinity and Structure Prediction (boltz_prediction)
Description: Boltz-2 based affinity and structure prediction.
Input Schema
| Field | Type | Required | Description |
|---|---|---|---|
protein_sequence |
string | yes | Protein sequence (one-letter amino acid code) |
ligand_smiles |
string | yes | Ligand SMILES |
Example Input
{
"protein_sequence": "MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAK",
"ligand_smiles": "CC1=CC=CC=C1"
}
For live job type info directly on Opal, always refer to:
python -m opal.main jobs get-job-types
or see the API_Reference.md for usage patterns and CLI/Python examples.
All Rights Reserved
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file azulene_opal-0.4.5.tar.gz.
File metadata
- Download URL: azulene_opal-0.4.5.tar.gz
- Upload date:
- Size: 89.3 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/6.2.0 CPython/3.14.2
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
6cf079e712ec35b073c4eaa7db469552e7bb8d38cf573a485edd7751d10dc952
|
|
| MD5 |
aca3a5f84640c4d2c577129787cf71fa
|
|
| BLAKE2b-256 |
8efa5df9c3902d972762c870e772d7e2260b9d53adf52f302c2b023d55529715
|
File details
Details for the file azulene_opal-0.4.5-py3-none-any.whl.
File metadata
- Download URL: azulene_opal-0.4.5-py3-none-any.whl
- Upload date:
- Size: 75.2 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/6.2.0 CPython/3.14.2
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
57983bdc6f71687c4c3ca43f90112ce8f56b87df783832d5d6c481f9bffba1fc
|
|
| MD5 |
ee0852c30eefdda0ee72c3c211f0980d
|
|
| BLAKE2b-256 |
801d5f1db7100d6cd0369c19d251e48bff26a3eeb68e2f662504ec4e2e2bb032
|