Antigen Receptor Classifier
Project description
ARC (Antigen Receptor Classifier)
Authors: Austin Crinklaw, Swapnil Mahajan
Requirements:
- Linux OS
- HMMER3
- NCBI Blast+
- Python 3+
- Python packages: Pandas, BioPython
Installation:
We provide a Dockerfile for ease of use.
ARC can also be downloaded through PyPI using the following pip command.
pip install bio-arc
Testing Installation:
A quick check for proper dependencies and successful installation can be performed by navigating to your pip package install directory (which can be located by executing pip show bio-arc) and running the following command:
python3 -m arc_test
Passing all unit-tests means that your system is configured properly and ready to classify some protein sequences.
Usage:
Input
- A fasta format file with one or more protein sequences.
>1WBZ_A_alpha I H2-Kb
MVPCTLLLLLAAALAPTQTRAGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPPSTVSNMATVAVLVVLGAAIVTGAVVAFVMKMRRRNTGGKGGDYALAPGSQTSDLSLPDCKVMVHDPHSLA
>1WBZ_B_b2m I H2-Kb
MARSVTLVFLVLVSLTGLYAIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM
Commands
- Using Fasta file as an input:
python -m ARC classify -i /path/to/input.fasta -o /path/to/output.csv
Output
- Output file has 4 columns in CSV format.
- First column named 'ID' is the description provoded in the fasta for each sequence.
- Second column named 'class' is the assigned molecule class for each sequence.
- e.g. MHC-I, MHC-II, BCR or TCR.
- The third column named 'chain_type' is the assigned chain type for each sequence.
- e.g. alpha, beta, heavy, lambda, kappa, scFv, TscFv or construct. These will also be labelled as V for variable domain or C for constant domain.
- The fourth column named 'calc_mhc_allele' is the MHC allele identified using groove domain similarity to MRO alleles.
| ID | class | chain_type | calc_mhc_allele |
|---|---|---|---|
| 1WBY_A_alpha I H2-Db | MHC-I | alpha V | |
| 1WBY_B_b2m I H2-Db | |||
| 1HQR_A_alpha II HLA-DRA01:01/DRB501:01 | MHC-II | alpha C | HLA-DRA*01:01 |
| 1HQR_B_beta II HLA-DRA01:01/DRB501:01 | MHC-II | beta C | HLA-DRB5*01:01 |
| 2CMR_H_heavy | BCR | heavy V | |
| 2CMR_L_light | BCR | kappa C | |
| 4RFO_L_light | BCR | lambda V | |
| 3UZE_A_heavy | BCR | scFv | |
| 1FYT_D_alpha | TCR | alpha V | |
| 1FYT_E_beta | TCR | beta C | |
| 3TF7_C_alpha | TCR | TscFv |
How it works:
- BCR and TCR chains are identified using HMMs. A given protein sequence is searched against HMMs built using BCR and TCR chain sequences from IMGT. HMMER is used to align an input sequence to the HMMs.
- MHC class I (alpha1-alpha2 domains) and MHC class I alpha and beta chain HMMs are downloaded from Pfam website. An input protein sequence is searched against these HMMs. A HMMER bit score threshold of 25 was used to identify MHC chain sequences.
- To identify MHC alleles, groove domains (G-domains) are assigned based on the MRO repository.
- IgNAR sequences are identified through querying against a custom blast database.
References:
Several methods for HMMER result parsing were sourced from ANARCI.
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file bio-arc-0.1.1.tar.gz.
File metadata
- Download URL: bio-arc-0.1.1.tar.gz
- Upload date:
- Size: 14.2 MB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.5.0 pkginfo/1.7.0 requests/2.22.0 requests-toolbelt/0.9.1 tqdm/4.61.0 CPython/3.8.5
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
9a8cb1407989e3567892c17f87693036733f5af7326914841e6d4dc1ef8089b4
|
|
| MD5 |
50bd90b025ba3312e8be17a45147be66
|
|
| BLAKE2b-256 |
3dd9fff4e0c14526e87dabe51e68ec9996d279ace08920f97b56c8b9735857a7
|
File details
Details for the file bio_arc-0.1.1-py3-none-any.whl.
File metadata
- Download URL: bio_arc-0.1.1-py3-none-any.whl
- Upload date:
- Size: 14.5 MB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.5.0 pkginfo/1.7.0 requests/2.22.0 requests-toolbelt/0.9.1 tqdm/4.61.0 CPython/3.8.5
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
262c1d0f86d4be9049625fcc79a9dffc4bc2c407281bba14420f0958ee5add44
|
|
| MD5 |
1f35f6906e31532f0dd2e61f1061c343
|
|
| BLAKE2b-256 |
6ba9947ab77440e5983832cf837b461042634075547d92d1b7a0c327930dbdad
|