biobase 0.8.0

A comprehensive package of biological constants, serving as a foundational resource for biology and bioinformatics, complemented by functions to streamline related tasks.

Biobase

A Python package providing standardized biological constants and scoring matrices for bioinformatics pipelines. Biobase aims to eliminate the need to repeatedly recreate common biological data structures and scoring systems in your code.

Table of Contents

• Quick Start
  • Access amino acid properties
  • Use scoring matrices
  • Analyze DNA sequences
  • Find protein motifs
  • Parse FASTA
• Requirements
• Installation
  • Regular Installation
  • Development Installation
• Running Files
• Data Files
• Project Goals
• Contributing
• Project Status
• License

Quick Start

Access amino acid properties

from biobase.constants import ONE_LETTER_CODES, MONO_MASS
print(ONE_LETTER_CODES)  # 'ACDEFGHIKLMNPQRSTVWY'
print(MONO_MASS['A'])    # 71.037113805

Use scoring matrices

from biobase.matrix import Blosum
blosum62 = Blosum(62)
print(blosum62['A']['A'])  # 4
print(blosum62['W']['C'])  # -2

Analyse DNA sequences

from biobase.analysis import Dna
sequence = "ATCGTAGC"
print(Dna.transcribe(sequence))               # 'AUCGUAGC'
print(Dna.complement(sequence))               # 'TAGCATCG'
print(Dna.complement(sequence, reverse=True)) # 'GCTACGAT'
print(Dna.calculate_gc_content(sequence))     # 50.0
print(Dna.calculate_at_content(sequence))     # 50.0
print(Dna.entropy(sequence))                  # 2.0

seq = "ccatgccctaaatggggtag"
for start, end, orf in Dna.find_orfs(seq, include_seq=True)
    print(start, end, orf)
# 2, 11, "ATGCCCTAA"
# 11, 20, "ATGGGGTAG"

Analyse Nucleotides

from biobase.analysis import Nucleotides

print(Nucleotides.molecular_weight("A"))               # 135.13
print(Nucleotides.cumulative_molecular_weight("ATCG")) # 523.48

Find protein motifs

from biobase.analysis import find_motifs
sequence = "ACDEFGHIKLMNPQRSTVWY"
print(find_motifs(sequence, "DEF"))
# [(1, 4)]

test_dict = {
    ">SP001": "ACDEFCDEFCDEFGHIKLMN",  # has matches for "CDE" that span indexes [(1, 4), (5, 8), (9, 12)]
    ">SP002": "MNPQRSTVWYACDEFGHIKL",  # has match for "CDE" that span indexes [(11, 14)]
    ">SP003": "AAAAAAAAAAAAAAAAAA12",  # invalid: contains "1", "2"
    ">SP004": "GGGGGGGGGGGGGGGGGGGG",  # no match
    ">SP005": "HHHHHHHHHHHHHHHHH@#$",  # invalid: contains "@", "#", "$"
    ">SP006": "DDDDDDDDDDDDDDDDDDDD",  # no match
    ">SP007": "CDEFGHCDEFKLCDEFPQRS",  # has matches for "CDE" that span indexes [(0, 3), (6, 9), (12, 15)]
    ">SP008": "LLLLLLLLLLLLLLLLLLLL",  # no match
    ">SP009": "KKKKKKKKKKKK123KKKKK",  # invalid: contains "1", "2", "3"
    ">SP010": "CDEACDEDCDEFAAAAAAAA",  # has matches for "CDE" that span indexes [(0, 3), (4, 7), (8, 11)]
}
matched, invalid, non_match = find_motifs(test_dict, "CDE")
print("Matches:")
for seq, matches in matched.items():
    print(f"{seq}")
    print(f"{"".join([f"{match[0]} to {match[1]}\n" for match in matches])}")
print(f"Invalid sequences:\n{"".join([f"{seq}: {invs}\n" for seq, invs in invalid.items()])}")
print(f"Sequences without matches:\n{"".join([f"- {nm}\n" for nm in non_match])}")

# Matches:
# >SP001
# 1 to 4
# 5 to 8
# 9 to 12

# >SP002
# 11 to 14

# >SP007
# 0 to 3
# 6 to 9
# 12 to 15

# >SP010
# 0 to 3
# 4 to 7
# 8 to 11

# Invalid sequences:
# >SP003: {'2', '1'}
# >SP005: {'$', '@', '#'}
# >SP009: {'2', '1', '3'}

# Sequences without matches:
# - >SP004
# - >SP006
# - >SP008

Parse FASTA

from biobase.parser import FastaParser, fasta_parser
fasta = """>CAA39742.1 cytochrome b (mitochondrion) [Sus scrofa]
MTNIRKSHPLMKIINNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHIC"""

# Class that yields generator
records = list(FastaParser(fasta))
r: FastaRecord = records[0]
print(r.id) # CAA39742.1
print(r.seq) # MTNIRKSHPLMKIINNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHIC

# Function that returns list
records = fasta_parser(fasta)
for r in records:
    print(r.id) # CAA39742.1
    print(r.seq) # MTNIRKSHPLMKIINNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHIC

Parse FASTQ

from biobase.parser import FastqParser, fastq_parser
fastq = """@2fa9ee19-5c51-4281-abdd-eac86
CGGTAGCCAGCTGCGTTCAGTATG
+
%%%+++'''@@@???<<<??????"""

# Class that yields generator
records = list(FastqParser(fastq))
r: FastqRecord = records[0]
print(r.id) # 2fa9ee19-5c51-4281-abdd-eac86
print(r.seq) # CGGTAGCCAGCTGCGTTCAGTATG

# Function that returns list
records = fastq_parser(fastq)
for r in records:
    print(r.id) # 2fa9ee19-5c51-4281-abdd-eac86
    print(r.seq) # CGGTAGCCAGCTGCGTTCAGTATG

Requirements

• Python 3.10+
• pip (for installation)

Installation

Regular Installation

pip install biobase

Development Installation

Clone the repository and install in editable mode:

git clone https://github.com/lignum-vitae/biobase.git
cd biobase
pip install -e .

Running Files

To ensure relative imports work correctly, always run files using the module path from the project root:

Run a specific file

python -m src.biobase.matrix

Data Files

• src/biobase/matrices/: Scoring matrix data stored in JSON file format

Project Goals

Biobase aims to provide Python-friendly versions of common biological constants and tools for bioinformatics pipelines. Key objectives:

1. Standardize biological data structures
2. Provide efficient implementations of common scoring systems
3. Ensure type safety and validation
4. Maintain comprehensive documentation
5. Support modern Python practices

Contributing

We welcome contributions! Please read our:

• Code of Conduct
• Contribution Guidelines

Stability

This project is in the beta stage. APIs may change without warning until version 1.0.0.

License

This project is licensed under the MIT License - see the LICENSE file for details.