Skip to main content

A package for easy integration with NVIDIA AI capabilities

Project description

BiomeAI

Simple Python package for Multiple Sequence Alignment search using NVIDIA's ColabFold.

Install

pip install biomeai

Quick Usage

from biomeai import ColabFoldMSA

# Initialize with API key
msa = ColabFoldMSA(api_key="your-api-key")
# Or set NVCF_RUN_KEY environment variable

# Your protein sequence
sequence = "MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFL"

# 1. Use a single database
results = msa.search_sync(
    sequence=sequence,
    databases=["Uniref30_2302"]
)

# 2. Use multiple databases
results = msa.search_sync(
    sequence=sequence,
    databases=["Uniref30_2302", "PDB70_220313"]
)

# 3. Use all databases (Cascaded Search)
results = msa.search_sync(
    sequence=sequence,
    databases=["Uniref30_2302", "PDB70_220313", "colabfold_envdb_202108"]
)

# Save results (optional)
msa.save_results(results, "results.json")

Available Databases

  • Uniref30_2302: Universal Reference Database
  • PDB70_220313: Protein Data Bank
  • colabfold_envdb_202108: Environmental Database

Additional Options

results = msa.search_sync(
    sequence=sequence,
    databases=["Uniref30_2302"],
    e_value=0.0001,        # E-value threshold
    iterations=1,          # Number of iterations
    output_formats=["a3m", "fasta"]  # Output formats
)

Async Support

import asyncio

async def search_msa():
    results = await msa.search(
        sequence=sequence,
        databases=["Uniref30_2302"]
    )
    return results

results = asyncio.run(search_msa())

Development

Install with development dependencies:

pip install biomeai[dev]

Run tests:

pytest

License

MIT License - see the LICENSE file for details.

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

biomeai-1.0.0.tar.gz (6.1 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

biomeai-1.0.0-py3-none-any.whl (5.7 kB view details)

Uploaded Python 3

File details

Details for the file biomeai-1.0.0.tar.gz.

File metadata

  • Download URL: biomeai-1.0.0.tar.gz
  • Upload date:
  • Size: 6.1 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/6.1.0 CPython/3.12.2

File hashes

Hashes for biomeai-1.0.0.tar.gz
Algorithm Hash digest
SHA256 725e9319f977d4e0fd3f2ad940d3c8bb70d7241d89539177da38045b734d4cab
MD5 55586f6b8a1bb9d6cde5f473286b8849
BLAKE2b-256 4be67ba120c9353d7ffedc010ee38195e2cf195050508aee76af114780ff941f

See more details on using hashes here.

File details

Details for the file biomeai-1.0.0-py3-none-any.whl.

File metadata

  • Download URL: biomeai-1.0.0-py3-none-any.whl
  • Upload date:
  • Size: 5.7 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/6.1.0 CPython/3.12.2

File hashes

Hashes for biomeai-1.0.0-py3-none-any.whl
Algorithm Hash digest
SHA256 a76aaf43166cd18f48ada62f57f80f07d755dc4be1ac08665fbb40c24a8618c3
MD5 08ce24f9134a6a23b3252a4a0d297409
BLAKE2b-256 8b1cd3e5dd0379e9c4a9b0c81ee2c4f5e134501ed0f51570a184571a690cc4a6

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page