BioMorphX (biomorphx v1.0.0)

Cross-Scale Mechano-Genomic, Biomaterial, Nanofabrication & Life-Critical Biomedical Engineering Python SDK
Developed and maintained under the Runtime-Slayers organization.

Table of Contents

1. Why BioMorphX Exists
2. Systematic Comparison with Existing Frameworks (Why Ours is New & Novel)
3. Omni-Scale Morpho-Mechanical Transduction Architecture
4. Core Submodules & One-Liner API Reference
5. Auxetic Implant & Bioprinting Workflow
6. Clinical ICU & Pharmacokinetic Safety Engine
7. Installation & Distribution
8. Command-Line Interface & Built-In Snippets
9. Comprehensive Verification Suite & Visual Showcase
10. Repository Layout
11. License

1. Why BioMorphX Exists

Modern biomedical computing is crippled by severe domain fragmentation. Existing Python libraries operate in isolated theoretical and physical silos:

• Sequence Libraries (Biopython) treat DNA, RNA, and proteins as static 1D ASCII character strings, entirely unaware of physical mechanics (Worm-Like Chain persistence length, Bell-Evans unfolding force $F^*$, and tension-gated cryptic motif exposure).
• Image Processing Libraries (scikit-image, OpenCV) diffuse pixel intensities through scalar Fickian heat equations or second-order Hessian eigenvalues, severing coherent speckle networks and erasing 3-way/4-way vascular and trabecular branching junctions.
• Biomaterial, 3D Bioprinting & ICU Systems lack a unified engine bridging Polymer/Hydrogel Rheology $\rightarrow$ 3D Auxetic Metamaterial G-Code/STL Generation with Nozzle Shear-Lysis Viability Auditing $\rightarrow$ Deterministic ICU Hemodynamic & Renal PK/PD Safety Guardrails.

biomorphx compresses translational workflows that previously required 150 to 400 lines of custom multi-physics code into single-line, unit-checked, cryptographically hash-stamped function calls.

2. Systematic Comparison with Existing Frameworks (Why Ours is New & Novel)

2.1 The Cross-Scale Capability Matrix

The table below contrasts BioMorphX against the standard computational tools across genomics, imaging, CAD/CAM, biomechanics, and clinical critical care:

2.2 The Six Foundational Novelties of BioMorphX

Novelty 1: Mechano-Genomics over Static String Bioinformatics

While existing sequence libraries treat biological polymers as inert text strings, biomorphx.seqmech grounds molecular biology in physical statistical mechanics:

• Marko-Siggia / Bustamante Worm-Like Chain (WLC): $$\frac{F L_p}{k_B T} = \frac{x}{L_c} + \frac{1}{4(1 - x/L_c)^2} - \frac{1}{4}$$ Predicts end-to-end peptide extension $x(F)$ under arbitrary physiological forces $F \in [0.1, 100]\text{ pN}$ using exact sequence-derived contour length $L_c = N \cdot l_0$ ($l_0 = 0.38\text{ nm}$) and residue-weighted persistence length $L_p$.
• Bell-Evans Force-Induced Transition Kinetics: $$F^*(r) = \frac{k_B T}{x^\ddagger} \ln\left(\frac{r x^\ddagger}{k_0 k_B T}\right)$$ Calculates dynamic unfolding rupture forces across experimental loading rates $r$, coupled with catch-bond lifetime expansions $\tau(F) = \tau_0 \exp\left(\frac{F x^\ddagger_{\text{catch}} - \Delta G^\ddagger}{k_B T}\right)$.
• Torque-Coupled CRISPR R-Loop Invasion: Combines SantaLucia (1998) nearest-neighbor thermodynamics ($\Delta H^\circ, \Delta S^\circ, \Delta G^\circ_{37}, T_m$) with negative supercoiling torsional energy $\tau = \frac{2\pi C \sigma}{\omega_0}$ to rank guide RNAs by physical DNA unwinding feasibility.

Novelty 2: Chrono-Harmonic Metamaterials over Passive Hydrogel Scripts

• 12-Tissue Native Atlas: Pre-calibrated mechanical profiles across 12 human tissues (brain cortex $\sim 1.2\text{ kPa}$, vocal fold $\sim 25\text{ kPa}$, myocardium $\sim 45\text{ kPa}$, articular cartilage $\sim 850\text{ kPa}$, cortical bone osteoid $\sim 18\text{ GPa}$).
• Fractional Zener Viscoelasticity + Negative Poisson Ratio ($\nu_{\text{eff}} < 0$): Couples dynamic storage $E'(\omega)$ and loss $E''(\omega)$ moduli with auxetic lateral expansion under tension, suppressing foreign-body myofibroblast differentiation via mechanotransductive YAP/TAZ nuclear exclusion and Piezo1 shear damping.
• Autocatalytic Ester Scission ODE: Solves coupled degradation differential equations tracking molecular weight loss $M_w(t)$, modulus retention $E(t)/E_0$, and local pore pH necrosis alert ($\text{pH} < 6.8$) with biphasic Korsmeyer-Peppas drug release.

Novelty 3: Non-Newtonian Extrusion & Viability Auditing over Blind Slicing

Standard 3D printing slicers assume rigid filaments and zero biological consequences. biomorphx.nanofab introduces:

• Herschel-Bulkley Bioink Rheology: $$\tau_w = \tau_y + K \left(\frac{3n + 1}{4n} \cdot \frac{32 Q}{\pi D_n^3}\right)^n$$ Computes true nozzle wall shear stress $\tau_w\text{ (Pa)}$ as a function of yield stress $\tau_y$, consistency index $K$, flow index $n$, flow rate $Q$, and nozzle diameter $D_n$.
• Live-Cell Viability Retention Auditor: Translates wall shear stress and residence time into empirical live-cell viability ($%$), raising a LifeCriticalSafetyWarning if viability drops below $85%$ or $\tau_w > 120\text{ Pa}$.
• Algorithmic Auxetic CAD Synthesis: Generates complete, ready-to-run 3D bioprinter .gcode and watertight .stl meshes from mathematical parametric formulations without external CAD software.

Novelty 4: Manifold Stress-Percolation PDE Filtering over Isotropic Diffusion

Traditional Gaussian or Fickian filters blur sharp bio-fibrils, while Hessian-based tubular filters (Frangi) erase multi-way branch points. biomorphx.imaging:

• Mechano-Beltrami Stress-Percolation (MBSP) Filter: Embeds 2D microscopy imagery as a 2D Riemannian manifold surface in spatial-intensity space $(\mathbf{x}, I(\mathbf{x}))$, applying stress-tensor anisotropic Beltrami flow: $$\frac{\partial I}{\partial t} = \frac{1}{\sqrt{g}} \text{div}\left(\sqrt{g} , G^{-1} \nabla I\right)$$ Bridges low-contrast speckle dropouts while strictly preserving 3-way, 4-way, and auxetic branch junctions.
• Automated Morphometry: Computes nematic alignment order parameter $S = \langle 2\cos^2\theta - 1 \rangle$, branching junction node density (nodes/$\text{mm}^2$), Euclidean Distance Transform (EDT) pore sizing, and topological Euler characteristic $\chi = \beta_0 - \beta_1$.

Novelty 5: Closed-Loop ICU Mechanical Power & PK/PD Guardrails over Passive Monitoring

• Gattinoni Mechanical Power of Ventilation: $$\text{Power} = 0.098 \cdot \text{RR} \cdot V_t \cdot \left(P_{\text{peak}} - \frac{\Delta P}{2}\right) \quad (\text{J/min})$$ Evaluates energy delivered to lung tissue per minute, enforcing Berlin ARDS staging and Ventilator-Induced Lung Injury (VILI) ergotrauma thresholds ($>17\text{ J/min}$ alert, $>27\text{ J/min}$ critical).
• Sawchuk-Zaske Intermittent IV Pharmacokinetic Engine: Implements Cockcroft-Gault creatinine clearance ($\text{CrCl}$) and 1-compartment kinetic dosing for narrow therapeutic index antibiotics (vancomycin, gentamicin, amikacin, tobramycin, colistin, meropenem), calculating steady-state peak ($C_{\max,\text{ss}}$), trough ($C_{\min,\text{ss}}$), and $\text{AUC}_{24}/\text{MIC}$ with acute kidney injury (AKI) guardrails.

Novelty 6: Finite-Sample Conformal Guarantees & SHA-256 Audit Trails over Silent Failures

• Strict Physiological Survival Bounds: Every function validates inputs against hard physical and physiological bounds (e.g. $\text{pH} \in [6.8, 7.8]$, $\text{MAP} \in [30, 200]\text{ mmHg}$), immediately throwing ClinicalBoundsError rather than propagating silent NaN values.
• Finite-Sample Split Conformal Prediction: Computes distribution-free conformal prediction intervals $[L, U]$ with non-asymptotic guaranteed marginal coverage $1 - \alpha$: $$P\left(Y_{n+1} \in \hat{C}(X_{n+1})\right) \ge 1 - \alpha$$ without Gaussian or parametric distribution assumptions.
• Cryptographic SHA-256 SafetyCertificate: Stamped on every execution, generating an immutable, tamper-evident audit record containing parameter digests, execution timestamps, metric snapshots, and safety risk tiers (SAFE_GREEN, CAUTION_AMBER, CRITICAL_RED).

3. Omni-Scale Morpho-Mechanical Transduction Architecture

BioMorphX bridges biological scales from single angstroms to whole-organ clinical dynamics through the Omni-Scale Morpho-Mechanical Transduction (OMMT) paradigm, governed at every boundary by mathematical safety certificates.

flowchart TD
    subgraph S1["Tier 1: Nanoscale Mechano-Genomics (biomorphx.seqmech)"]
        A1["Amino Acid & DNA Input"] --> A2["Worm-Like Chain (WLC) Force-Extension"]
        A2 --> A3["Bell-Evans Bond Kinetics (F*)"]
        A3 --> A4["Cryptic Mechano-Motif Scanner (RGD/PHSRN)"]
        A4 --> A5["SantaLucia CRISPR R-Loop & CAI mRNA Optimizer"]
    end

    subgraph S2["Tier 2: Microscale Biomaterials & Rheology (biomorphx.biomaterials)"]
        B1["12-Tissue Native Atlas Matching"] --> B2["Fractional Zener Dynamic Viscoelasticity"]
        B2 --> B3["Auxetic Negative Poisson Metamaterials (nu < 0)"]
        B3 --> B4["Flory-Rehner Mesh Size (xi) & YAP/TAZ Fibrosis Prediction"]
        B4 --> B5["Autocatalytic Ester Scission ODE & Degradation Half-Life"]
    end

    subgraph S3["Tier 3: Mesoscale Nanofab & Microfluidics (biomorphx.nanofab)"]
        C1["Herschel-Bulkley Nozzle Shear Engine"] --> C2["Live-Cell Shear Lysis Auditor (>85% Viability)"]
        C2 --> C3["Watertight Auxetic 3D STL & G-Code Generator"]
        C3 --> C4["Staggered Herringbone LNP Damkohler Assembly"]
    end

    subgraph S4["Tier 4: Continuum Mechano-Imaging (biomorphx.imaging)"]
        D1["Microscopy & Spatial Bio-Imaging"] --> D2["4-Stage Mechano-Beltrami PDE Stress Filter"]
        D2 --> D3["Nematic Alignment Order Parameter (S)"]
        D3 --> D4["Topological Euler Characteristic (Chi = B0 - B1)"]
    end

    subgraph S5["Tier 5: Macroscale Clinical ICU & PK/PD (biomorphx.clinical)"]
        E1["Ventilator Waveform & Blood Gas (ABG)"] --> E2["Gattinoni Mechanical Power of Ventilation (J/min)"]
        E2 --> E3["Berlin ARDS & VILI Driving Pressure Audit"]
        E3 --> E4["Cockcroft-Gault & Sawchuk-Zaske PK/PD Drug Atlas"]
    end

    subgraph S0["Pervasive Cross-Cutting: Life-Critical Safety (biomorphx.safety)"]
        F1["Physiological Hard Bounds (ClinicalBoundsError)"]
        F2["Finite-Sample Split Conformal Safety Intervals"]
        F3["Cryptographic SHA-256 SafetyCertificate Audit Trails"]
    end

    S1 --> S2
    S2 --> S3
    S3 --> S4
    S4 --> S5
    S0 -.->|Pervasive Guardrails| S1
    S0 -.->|Pervasive Guardrails| S2
    S0 -.->|Pervasive Guardrails| S3
    S0 -.->|Pervasive Guardrails| S4
    S0 -.->|Pervasive Guardrails| S5

4. Core Submodules & One-Liner API Reference

5. Auxetic Implant & Bioprinting Workflow

The following flowchart outlines the automated pipeline from patient tissue matching down to G-code execution, STL generation, and autocatalytic degradation tracking:

flowchart LR
    TargetTissue["Target Tissue Selection\n(e.g., Myocardium, E = 45 kPa)"] --> CHAM["CHAM Hydrogel Formulation\n(Fractional Zener + Auxetic nu = -0.28)"]
    CHAM --> ShearAudit{"Herschel-Bulkley\nWall Shear Audit\n(tau_w <= 120 Pa?)"}
    ShearAudit -- "tau_w > 120 Pa\n(Cell Lysis Hazard)" --> SpeedAdjust["Auto-Scale Nozzle D_n\nor Reduce Print Speed"]
    SpeedAdjust --> ShearAudit
    ShearAudit -- "tau_w <= 120 Pa\n(Viability >= 85%)" --> GCodeSTL["Generate G-Code Toolpath\n& Watertight STL Mesh"]
    GCodeSTL --> DegradationAudit["PLGA Degradation ODE\n(Local Acidic Pore pH >= 6.8?)"]
    DegradationAudit -- "Safe" --> Cert["SHA-256 SafetyCertificate\n(SAFE_GREEN Tier)"]
    DegradationAudit -- "Acidic Risk" --> Alert["LifeCriticalSafetyWarning\n(CAUTION_AMBER Tier)"]

6. Clinical ICU & Pharmacokinetic Safety Engine

In critical care scenarios, BioMorphX executes deterministic physiological audit loops with hard boundary interrupts (ClinicalBoundsError) and real-time stratification:

flowchart TD
    PatientSensors["ICU Patient Telemetry\n(HR, BP, PaO2/FiO2, P_plat, PEEP, V_t, Cr, Weight)"] --> Splitter{"Clinical Audit Router"}
    
    Splitter -->|Respiratory Mechanics| VentEngine["Gattinoni Mechanical Power Engine\nPower = 0.098 * RR * V_t * (P_peak - dP/2)"]
    VentEngine --> BerlinCheck{"Berlin ARDS & Driving Pressure\n(dP <= 15 cmH2O & Power <= 17 J/min?)"}
    BerlinCheck -- "Safe" --> VentOK["Normative Lung-Protective Ventilation\n(SAFE_GREEN)"]
    BerlinCheck -- "Exceeded" --> VentWarn["VILI Barotrauma / Ergotrauma Alert\n(CRITICAL_RED)"]

    Splitter -->|Renal Antibiotic TDM| PKEngine["Sawchuk-Zaske Intermittent IV Engine\n(Cockcroft-Gault CrCl & 1-Compartment PK)"]
    PKEngine --> Corridors{"Therapeutic TDM Corridors\n(C_trough, C_peak, AUC24/MIC)"}
    Corridors -- "Inside Corridor" --> DoseOK["Recommended Dosing Interval & Infusion Time\n(SAFE_GREEN)"]
    Corridors -- "Nephrotoxic Trough" --> DoseWarn["Immediate Interval Extension & Dose Taper\n(CRITICAL_RED)"]

7. Installation & Distribution

Option 1: Install Directly from the GitHub Repository

pip install git+https://github.com/Runtime-Slayers/BioMorphX.git

Option 2: Install from Pre-Built Wheel (Offline Immediate)

# Clone the repository
git clone https://github.com/Runtime-Slayers/BioMorphX.git
cd BioMorphX

# Install the wheel bundled in dist/
pip install ./dist/biomorphx-1.0.0-py3-none-any.whl

Option 3: Developer / Editable Installation

git clone https://github.com/Runtime-Slayers/BioMorphX.git
cd BioMorphX
pip install -e .

Option 4: Zero-Dependency Single-File SDK (biomorphx.py)

For air-gapped clinical workstations, embedded controllers, or HPC clusters, biomorphx.py is an autonomous drop-in SDK containing the entire engine in a single file with zero external dependencies beyond NumPy and SciPy.

8. Command-Line Interface & Built-In Snippets

BioMorphX provides a full CLI for executing self-tests and running standard translational workflows:

# Verify version
biomorphx --version

# Run deterministic self-test across all 12 pipelines
biomorphx self-test

# List all 12 built-in biomedical one-liner pipelines
biomorphx list-snippets

# View Python source code of any snippet
biomorphx show-snippet 06_bioprinter_gcode_and_stl

# Execute snippet directly with JSON output
biomorphx run-snippet 09_icu_ventilator_power_audit

Python SDK Quickstart

import biomorphx as bmx

# 1. Nanoscale Mechano-Genomic Single-Molecule Analysis
protein = bmx.analyze_mechano_protein(
    sequence="TVYAVTGRGDSPASSKPISINYRTEIDKPSQ",
    pH=7.4,
    applied_force_pN=12.0
)
print("Unfolding Force (pN):", protein["unfolding_force_pN"])
print("Bioactive Motifs:", protein["bioactive_motifs_detected"])

# 2. 3D Auxetic Metamaterial Bioprinting Toolpath & Mesh
fab = bmx.generate_auxetic_gcode_and_stl(
    width_mm=12.0,
    height_mm=12.0,
    layers=4,
    nozzle_diameter_um=200.0,
    print_speed_mm_s=8.0,
    out_gcode_path="examples/auxetic_myocardial_scaffold.gcode",
    out_stl_path="examples/auxetic_myocardial_scaffold.stl"
)
print("Cell Viability (%):", fab["predicted_cell_viability_pct"])
print("Auxetic Poisson Ratio:", fab["geometric_auxetic_poisson_ratio"])

# 3. ICU Hemodynamic & Ventilator Mechanical Power Audit
icu = bmx.audit_icu_hemodynamics_ventilation(
    hr_bpm=84,
    sbp_mmHg=118,
    dbp_mmHg=76,
    plateau_pressure_cmH2O=16.0,
    peak_pressure_cmH2O=22.0,
    peep_cmH2O=6.0,
    tidal_volume_ml=450.0
)
print("Mechanical Power (J/min):", icu["gattinoni_mechanical_power_J_min"])
print("Safety Certificate:", icu["safety_certificate"]["risk_tier"])

9. Comprehensive Verification Suite & Visual Showcase

BioMorphX ships with a 15-test life-critical verification suite (40+ assertions) validating every mathematical formula, boundary check, and output format.

python tests/test_biomorphx.py

Running the verification suite automatically generates the 6-panel publication-grade visual showcase dashboard:

• Panel A: Worm-Like Chain (WLC) Single-Molecule Force Spectroscopy curves ($x(F)$ vs $F^*$).
• Panel B: 12-Tissue Native Atlas foreign-body fibrosis suppression with auxetic hydrogels ($\nu < 0$).
• Panel C: Autocatalytic scaffold degradation kinetics, modulus retention $E(t)/E_0$, and local pore pH necrosis alert.
• Panel D: Non-Newtonian Herschel-Bulkley nozzle shear stress vs. predicted live-cell viability across printing speeds.
• Panel E: 4-Stage Mechano-Beltrami Stress-Percolation (MBSP) filter with nematic alignment order $S$ and branching node detection.
• Panel F: Renal-adjusted vancomycin PK/PD therapeutic corridor and nephrotoxicity trough boundaries across creatinine clearance.

The rendered high-resolution figures are exported to:

• examples/biomorphx_sdk_showcase.png
• examples/biomorphx_sdk_showcase.pdf

10. Repository Layout

BioMorphX/
├── .github/
│   └── workflows/
│       ├── ci.yml                     # Automated multi-OS, multi-Python test matrix
│       └── publish_pypi.yml           # Automated PyPI release workflow on tag
├── biomorphx/
│   ├── __init__.py                    # Clean submodule namespaces (safety, seqmech, etc.)
│   ├── cli.py                         # Console CLI entrypoint (biomorphx command)
│   └── core.py                        # Full cross-scale OMMT mathematical implementation
├── dist/
│   ├── biomorphx-1.0.0-py3-none-any.whl  # Pre-compiled Wheel for immediate offline pip install
│   └── biomorphx-1.0.0.tar.gz         # Source distribution tarball
├── docs/
│   └── README_BioMorphX_Installation_Guide.md.pdf # Comprehensive illustrated guide
├── examples/
│   ├── auxetic_myocardial_scaffold.gcode # Real generated 3D bioprinter toolpath
│   ├── auxetic_myocardial_scaffold.stl   # Watertight 3D printable auxetic mesh
│   ├── biomorphx_sdk_showcase.png        # 6-Panel publication-grade visual showcase
│   └── biomorphx_sdk_showcase.pdf        # High-res vector dashboard
├── tests/
│   └── test_biomorphx.py              # 15-Test life-critical verification suite
├── .gitignore                         # Python, OS, and build artifact exclusions
├── biomorphx.py                       # Standalone zero-dependency single-file SDK
├── biomorphx_developer_guide.md       # Extended API guide and derivation notes
├── install_on_any_laptop.sh           # Unix/macOS one-click automated installer
├── install_on_windows.bat             # Windows one-click automated installer
├── publish_to_public_pypi.sh          # PyPI distribution release script
├── pyproject.toml                     # PEP 517/518 build specification
├── setup.py                           # Setuptools package configuration
└── LICENSE                            # MIT License

11. License

BioMorphX is licensed under the MIT License.
Copyright (c) 2026 BioMorphX Research Consortium & Runtime-Slayers.