Skip to main content

Python client for Boltz-2 protein structure prediction API with covalent complex and multi-endpoint support

Project description

Boltz-2 Python Client

Copyright (c) 2025-2026, NVIDIA CORPORATION. All rights reserved.

PyPI version Python 3.8+ License: MIT

A comprehensive Python client for NVIDIA's Boltz-2 biomolecular structure prediction service. This package provides both synchronous and asynchronous interfaces, a rich CLI, and built-in 3D visualization capabilities.

Features

  • Boltz2 NIM v1.6 Support — Compatible with the latest NVIDIA Boltz2 NIM
  • Full API Coverage — Protein folding, protein-ligand, covalent, DNA-protein, YAML configs
  • Async & Sync Clients — Choose your preferred programming style
  • Rich CLI Interface — Beautiful command-line tools with progress bars
  • Flexible Endpoints — Local deployments, NVIDIA hosted API, or AWS SageMaker
  • Affinity Prediction — Predict binding affinity (pIC50) for protein-ligand complexes
  • Virtual Screening — High-level API for drug discovery campaigns
  • MSA Search Integration — GPU-accelerated MSA generation with NVIDIA MSA Search NIM
  • A3M to Multimer MSA — Convert ColabFold A3M files to paired multimer format
  • Multi-Endpoint Load Balancing — Distribute predictions across multiple NIMs
  • PAE/PDE Matrix Output — Full Predicted Aligned Error and Distance Error matrices
  • Structural Templates — Template-guided structure prediction

Installation

# From PyPI
pip install boltz2-python-client

# With SageMaker support
pip install "boltz2-python-client[sagemaker]"

# From source
git clone https://github.com/NVIDIA/digital-biology-examples.git
cd digital-biology-examples/examples/nims/boltz-2
pip install -e ".[dev]"

Quick Start

Python API

import asyncio
from boltz2_client import Boltz2Client

async def main():
    client = Boltz2Client(base_url="http://localhost:8000")

    # Simple protein prediction
    result = await client.predict_protein_structure(
        sequence="MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"
    )
    print(f"Confidence: {result.confidence_scores[0]:.3f}")

    # MSA-guided prediction
    result = await client.predict_protein_structure(
        sequence="MKTVRQERLK...",
        msa_files=[("alignment.a3m", "a3m")],
        recycling_steps=3,
        sampling_steps=200,
    )

asyncio.run(main())

Synchronous API

from boltz2_client import Boltz2SyncClient

client = Boltz2SyncClient(base_url="http://localhost:8000")
result = client.predict_protein_structure(sequence="MKTVRQ...")

CLI

# Health check
boltz2 health

# Protein structure
boltz2 protein "SEQUENCE" --recycling-steps 3 --sampling-steps 200

# Protein-ligand with affinity
boltz2 ligand "SEQUENCE" --smiles "CC(=O)OC1=CC=CC=C1C(=O)O" --predict-affinity

# Covalent complex
boltz2 covalent "SEQUENCE" --ccd U4U --bond A:11:SG:L:C22

# Virtual screening
boltz2 screen "SEQUENCE" compounds.csv -o results/

# Multimer from A3M files
boltz2 multimer-msa chain_A.a3m chain_B.a3m -c A,B -o complex.cif --save-all

# Multi-endpoint load balancing
boltz2 --multi-endpoint --base-url "http://gpu1:8000,http://gpu2:8000" protein "SEQUENCE"

Configuration

Local Endpoint (Default)

client = Boltz2Client(base_url="http://localhost:8000")

NVIDIA Hosted Endpoint

client = Boltz2Client(
    base_url="https://health.api.nvidia.com",
    api_key="your_api_key",  # or set NVIDIA_API_KEY env var
    endpoint_type="nvidia_hosted",
)

AWS SageMaker Endpoint

client = Boltz2Client(
    endpoint_type="sagemaker",
    sagemaker_endpoint_name="my-boltz2-endpoint",
    sagemaker_region="us-east-1",
)

Requires pip install "boltz2-python-client[sagemaker]" and AWS credentials.

# CLI
boltz2 --endpoint-type sagemaker --sagemaker-endpoint-name my-boltz2-endpoint health

Supported Prediction Types

Type CLI Command Python Method
Protein folding protein predict_protein_structure()
Protein-ligand ligand predict_protein_ligand_complex()
Covalent complex covalent predict_covalent_complex()
DNA-protein dna-protein predict_dna_protein_complex()
Advanced advanced predict_with_advanced_parameters()
YAML config yaml predict_from_yaml_config()
Virtual screening screen VirtualScreening.screen()
MSA search msa-search client.search_msa()
Multimer MSA multimer-msa A3M conversion + predict()

Boltz-2 NIM v1.6 Parameter Limits

Parameter Range
recycling_steps 1–10
diffusion_samples 1–25
sampling_steps 10–1000
polymers up to 12
ligands up to 20

Local Deployment

export NGC_API_KEY=<your_key>
export LOCAL_NIM_CACHE=~/.cache/nim
mkdir -p $LOCAL_NIM_CACHE && chmod -R 777 $LOCAL_NIM_CACHE

docker run -it --runtime=nvidia --shm-size=16G \
    -p 8000:8000 -e NGC_API_KEY \
    -v "$LOCAL_NIM_CACHE":/opt/nim/.cache \
    nvcr.io/nim/mit/boltz2:1.6.0

Examples

The examples/ directory contains tutorial scripts, notebooks, and standalone demos:

Tutorial Scripts (examples/):

File Description
01_basic_protein_folding.py Simple protein structure prediction
02_protein_structure_prediction_with_msa.py MSA-guided predictions
03_protein_ligand_complex.py Protein-ligand complexes
04_covalent_bonding.py Covalent bond constraints
05_dna_protein_complex.py DNA-protein interactions
06_yaml_configurations.py YAML config files
07_advanced_parameters.py Advanced API parameters
08_affinity_prediction_simple.py Binding affinity prediction
09_virtual_screening.py Virtual screening
10_msa_search_integration.py GPU-accelerated MSA search + prediction
11_msa_search_large_protein.py Large protein MSA optimization
12_msa_affinity_prediction.py MSA-guided affinity prediction
13_a3m_to_multimer_csv.py A3M to multimer MSA conversion

Notebooks (examples/notebooks/):

File Description
01_multimer_prediction.ipynb Heterodimer/homodimer prediction
02_cdk4_msa_affinity_prediction.ipynb CDK4-Palbociclib MSA + affinity workflow
03_colabfold_a3m_to_multimer.ipynb ColabFold A3M multimer pairing

Documentation

Guide Description
Parameters Detailed parameter documentation
YAML Configuration Working with YAML config files
Affinity Prediction Binding affinity (pIC50) guide
Virtual Screening Drug discovery campaigns
MSA Search GPU-accelerated MSA generation
A3M Multimer MSA ColabFold A3M conversion
Multi-Endpoint Load balancing across NIMs
Covalent Complex Covalent bond predictions
Async Guide Async programming best practices
Changelog Release history

Development

pip install -e ".[dev]"
pytest tests/                                           # mock tests only
pytest tests/ -m real_endpoint                          # live endpoint tests
BOLTZ2_NIM_URL=http://your-nim:8000 pytest tests/ -v   # all tests

Requirements

  • Python 3.8+
  • Core: httpx, pydantic, rich, click, PyYAML, aiofiles, aiohttp, py3Dmol
  • Optional: boto3 (SageMaker), pandas (dev)

License

MIT License — see LICENSE. Third-party licenses in licenses/.

Links


Disclaimer

This software is provided as-is without warranties of any kind. No guarantees are made regarding the accuracy, reliability, or fitness for any particular purpose. The underlying models and APIs are experimental and subject to change without notice. Users are responsible for validating all results and assessing suitability for their specific use cases.


Made with care for the computational biology community

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

boltz2_python_client-0.5.0.tar.gz (1.2 MB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

boltz2_python_client-0.5.0-py3-none-any.whl (826.1 kB view details)

Uploaded Python 3

File details

Details for the file boltz2_python_client-0.5.0.tar.gz.

File metadata

  • Download URL: boltz2_python_client-0.5.0.tar.gz
  • Upload date:
  • Size: 1.2 MB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/6.2.0 CPython/3.12.3

File hashes

Hashes for boltz2_python_client-0.5.0.tar.gz
Algorithm Hash digest
SHA256 a1ca3d86cdc4f3088d70e59aca519b815cba5d6a2fe195d7fdebea7ca35e9174
MD5 fb8dc4fc9db5a497a49c586b4a6ed3eb
BLAKE2b-256 68d689aef94535b9005a6cc5145f9e505de3b063d7ff5f07f909b5434e009f26

See more details on using hashes here.

File details

Details for the file boltz2_python_client-0.5.0-py3-none-any.whl.

File metadata

File hashes

Hashes for boltz2_python_client-0.5.0-py3-none-any.whl
Algorithm Hash digest
SHA256 d917dec89b917bbc28e7a8ec8fa73ae2c66db209ca7dd89d17f30640311030c6
MD5 1a53faef3b74d86889532989dfdc2b56
BLAKE2b-256 0e20c54c6094f3d8a5ced73e4466fd7d63b7682a6c97841a7b9c3a4b2d217767

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page