Skip to main content

No project description provided

Project description

A pipeline for enzyme engineering

Enzyme-tk is a collection of tools for enzyme engineering, setup as interoperable modules that act on dataframes. These modules are designed to be imported into pipelines for specific function. For this reason, steps as each module is called (e.g. finding similar proteins with BLAST would be considered a step) are designed to be as light as possible. An example of a pipeline is the annotate-e ` pipeline, this acts to annotate a fasta with an ensemble of methods (each is designated as an Enzyme-tk step).

Installation

Install base package to import modules

pip install enzymetk

Install only the specific requirements you need (recomended)

For this clone the repo and then install the requirements for the specific modules you use

git clone git@github.com:ArianeMora/enzyme-tk.git
cd enzymetk/conda_envs/ # would recommend looking at thes
# e.g. to install all from within that folder you would do
source install_all.sh

Usage

If you have any issues at all just email me using my caltech email: amora at caltech . edu

This is a work-in progress! e.g. some tools (e.g. proteInfer and CLEAN) require extra data to be downloaded in order to run (like model weights.) I'm working on integrating these atm, buzz me if you need this!

Here are some of the tools that have been implemented to be chained together as a pipeline:

mmseqs2
foldseek
diamond
proteinfer
CLEAN
chai
chemBERTa2
SELFormer
rxnfp
clustalomega
CREEP
esm
LigandMPNN
vina
Uni-Mol
fasttree
Porechop
prokka

Things to note

All the tools use the conda env of enzymetk by default.

If you want to use a different conda env, you can do so by passing the env_name argument to the constructor of the step.

For example:

proteinfer = ProteInfer(env_name='proteinfer')

Arguments

All the arguments are passed to the constructor of the step, the ones that are required are passed as arguments to the constructor and the ones that are optional are passed as a list to the args argument, this needs to be a list as one would normally pass arguments to a command line tool.

For example:

proteinfer = ProteInfer(env_name='proteinfer', args=['--num_threads', '10'])

For those wanting to use specific arguments, check the individual tools for specifics.

Steps

The steps are the main building blocks of the pipeline. They are responsible for executing the individual tools.

BLAST

BLAST is a tool for searching a database of sequences for similar sequences. Here you can either pass a database that you have already created or pass the sequences as part of your dataframe and pass the label column (this needs to have two values: reference and query) reference refers to sequences that you want to search against and query refers to sequences that you want to search for.

id_col = 'Entry'
seq_col = 'Sequence'
label_col = 'label'
rows = [['AXE2_TALPU', 'query', 'MHSKFFAASLLGLGAAAIPLEGVMEKRSCPAIHVFGARETTASPGYGSSSTVVNGVLSAYPGSTAEAINYPACGGQSSCGGASYSSSVAQGIAAVASAVNSFNSQCPSTKIVLVGYSQGGEIMDVALCGGGDPNQGYTNTAVQLSSSAVNMVKAAIFMGDPMFRAGLSYEVGTCAAGGFDQRPAGFSCPSAAKIKSYCDASDPYCCNGSNAATHQGYGSEYGSQALAFVKSKLG'],
        ['AXE2_TALPU', 'reference', 'MHSKFFAASLLGLGAAAIPLEGVMEKRSCPAIHVFGARETTASPGYGSSSTVVNGVLSAYPGSTAEAINYPACGGQSSCGGASYSSSVAQGIAAVASAVNSFNSQCPSTKIVLVGYSQGGEIMDVALCGGGDPNQGYTNTAVQLSSSAVNMVKAAIFMGDPMFRAGLSYEVGTCAAGGFDQRPAGFSCPSAAKIKSYCDASDPYCCNGSNAATHQGYGSEYGSQALAFVKSKLG'],
        ['AXE2_GEOSE', 'reference', 'MKIGSGEKLLFIGDSITDCGRARPEGEGSFGALGTGYVAYVVGLLQAVYPELGIRVVNKGISGNTVRDLKARWEEDVIAQKPDWVSIMIGINDVWRQYDLPFMKEKHVYLDEYEATLRSLVLETKPLVKGIILMTPFYIEGNEQDPMRRTMDQYGRVVKQIAEETNSLFVDTQAAFNEVLKTLYPAALAWDRVHPSVAGHMILARAFLREIGFEWVRSR'], 
        ['AXE7A_XYLR2', 'referece', 'MFNFAPKQTTEMKKLLFTLVFVLGSMATALAENYPYRADYLWLTVPNHADWLYKTGERAKVEVSFCLYGMPQNVEVAYEIGPDMMPATSSGKVTLKNGRAVIDMGTMKKPGFLDMRLSVDGKYQHHVKVGFSPELLKPYTKNPQDFDAFWKANLDEARKTPVSVSCNKVDKYTTDAFDCYLLKIKTDRRHSIYGYLTKPKKAGKYPVVLCPPGAGIKTIKEPMRSTFYAKNGFIRLEMEIHGLNPEMTDEQFKEITTAFDYENGYLTNGLDDRDNYYMKHVYVACVRAIDYLTSLPDWDGKNVFVQGGSQGGALSLVTAGLDPRVTACVANHPALSDMAGYLDNRAGGYPHFNRLKNMFTPEKVNTMAYYDVVNFARRITCPVYITWGYNDNVCPPTTSYIVWNLITAPKESLITPINEHWTTSETNYTQMLWLKKQVK'], 
        ['A0A0B8RHP0_LISMN', 'reference', 'MKKLLFLGDSVTDAGRDFENDRELGHGYVKIIADQLEQEDVTVINRGVSANRVADLHRRIEADAISLQPDVVTIMIGINDTWFSFSRWEDTSVTAFKEVYRVILNRIKTETNAELILMEPFVLPYPEDRKEWRGDLDPKIGAVRELAAEFGATLIPLDGLMNALAIKHGPTFLAEDGVHPTKAGHEAIASTWLEFTK']]
df = pd.DataFrame(rows, columns=[id_col, label_col, seq_col])
df << (BLAST(id_col, seq_col, label_col) >> Save('tmp/blast_test.pkl'))

ActiveSitePred

ActiveSitePred is a tool for predicting the active site of an enzyme. This returns a dataframe with the active site prediction for each sequence, and the probability of the active site. Note we use a zero index for the active site prediction while UniProt uses a one index.

squidly_dir = '/disk1/share/software/AS_inference/' # This should be where you downloaded the data from zotero, there is a folder in there called AS_inference
num_threads = 1
id_col = 'Entry'
seq_col = 'Sequence'
rows = [['AXE2', 'MKIGSGEKLLFIGDSITDCGRARPEGEGSFGALGTGYVAYVVGLLQAVYPELGIRVVNKGISGNTVRDLKARWEEDVIAQKPDWVSIMIGINDVWRQYDLPFMKEKHVYLDEYEATLRSLVLETKPLVKGIILMTPFYIEGNEQDPMRRTMDQYGRVVKQIAEETNSLFVDTQAAFNEVLKTLYPAALAWDRVHPSVAGHMILARAFLREIGFEWVRSR'], 
        ['H7C0D0', 'XRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQTVAGYTIPPGHQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK']]
df = pd.DataFrame(rows, columns=[id_col, seq_col])
print(df)
df << (ActiveSitePred(id_col, seq_col, squidly_dir, num_threads) >> Save('tmp/squidly_as_pred.pkl'))

Chai

Chai is a tool for predicting the structure of a protein and a ligand, this tool outputs the data to a new folder and creates directories based on the id that is passed. We return the paths to the specific structure for each id in the returned dataframe.

Requres the docko conda environment to be created.

output_dir = 'tmp/'
num_threads = 1
id_col = 'Entry'
seq_col = 'Sequence'
substrate_col = 'Substrate'
rows = [['P0DP23', 'MALWMRLLPLLALLALWGPDPAAAMALWMRLLPLLALLALWGPDPAAAMALWMRLLPLLALLALWGPDPAAA', 'CCCCC(CC)COC(=O)C1=CC=CC=C1C(=O)OCC(CC)CCCC'], 
        ['AXE2', 'MKIGSGEKLLFIGDSITDCGRARPEGEGSFGALGTGYVAYVVGLLQAVYPELGIRVVNKGISGNTVRDLKARWEEDVIAQKPDWVSIMIGINDVWRQYDLPFMKEKHVYLDEYEATLRSLVLETKPLVKGIILMTPFYIEGNEQDPMRRTMDQYGRVVKQIAEETNSLFVDTQAAFNEVLKTLYPAALAWDRVHPSVAGHMILARAFLREIGFEWVRSR', 'CCCCC(CC)COC(=O)C1=CC=CC=C1C(=O)OCC(CC)CCCC']]
df = pd.DataFrame(rows, columns=[id_col, seq_col, substrate_col])
print(df)
df << (Chai(id_col, seq_col, substrate_col, f'{output_dir}', num_threads) >> Save(f'{output_dir}test.pkl'))

ChemBERTa

ChemBERTa2 encodes reactions and SMILES strings into a vector space. Note this requires the base environment, i.e. enzymetk conda env.

from enzymetk.embedchem_chemberta_step import ChemBERT
from enzymetk.save_step import Save

output_dir = 'tmp/'
num_threads = 1
id_col = 'Entry'
seq_col = 'Sequence'
substrate_col = 'Substrate'
rows = [['P0DP23', 'MALWMRLLPLLALLALWGPDPAAAMALWMRLLPLLALLALWGPDPAAAMALWMRLLPLLALLALWGPDPAAA', 'CCCCC(CC)COC(=O)C1=CC=CC=C1C(=O)OCC(CC)CCCC'], 
        ['P0DP24', 'MALWMRLLPLLALLALWGPDPAAAMALWMRLLPLLALLALWGPDPAAAMALWMRLLPLLALLALWGPDPAAA', 'CCCCC(CC)COC(=O)C1=CC=CC=C1C(=O)OCC(CC)CCCC']]
df = pd.DataFrame(rows, columns=[id_col, seq_col, substrate_col])
new_df = (df << (ChemBERT(id_col, substrate_col, num_threads) >> Save(f'{output_dir}chemberta.pkl')))

CLEAN

CLEAN is a tool for predicting the EC number of an enzyme.

output_dir = 'tmp/'
num_threads = 1
id_col = 'Entry'
seq_col = 'Sequence'
substrate_col = 'Substrate'
rows = [['P0DP23', 'MALWMRLLPLLALLALWGPDPAAAMALWMRLLPLLALLALWGPDPAAAMALWMRLLPLLALLALWGPDPAAA', 'CCCCC(CC)COC(=O)C1=CC=CC=C1C(=O)OCC(CC)CCCC'], 
        ['AXE2', 'MKIGSGEKLLFIGDSITDCGRARPEGEGSFGALGTGYVAYVVGLLQAVYPELGIRVVNKGISGNTVRDLKARWEEDVIAQKPDWVSIMIGINDVWRQYDLPFMKEKHVYLDEYEATLRSLVLETKPLVKGIILMTPFYIEGNEQDPMRRTMDQYGRVVKQIAEETNSLFVDTQAAFNEVLKTLYPAALAWDRVHPSVAGHMILARAFLREIGFEWVRSR', 'CCCCC(CC)COC(=O)C1=CC=CC=C1C(=O)OCC(CC)CCCC']]
df = pd.DataFrame(rows, columns=[id_col, seq_col, substrate_col])
# This should be relative to the location of the script if you installed via the install_all.sh script
# Note you need to have downloaded their predictive models (ToDo )
clean_dir = 'software/CLEAN/app/'
df << (CLEAN(id_col, seq_col, clean_dir, num_threads=num_threads) >> Save(f'clean_missing_EC_seqs.pkl'))

ClustalOmega

ClustalOmega is a tool for aligning a set of sequences. This gets installed to the system (expecting a linux machine) and added to the bash path. You need to have installed it first (check out the conda_envs directory in enzymetk.)

from enzymetk.generate_msa_step import ClustalOmega
from enzymetk.save_step import Save
import pandas as pd

id_col = 'Entry'
seq_col = 'Sequence'
label_col = 'label'
rows = [['AXE2_TALPU', 'query', 'MHSKFFAASLLGLGAAAIPLEGVMEKRSCPAIHVFGARETTASPGYGSSSTVVNGVLSAYPGSTAEAINYPACGGQSSCGGASYSSSVAQGIAAVASAVNSFNSQCPSTKIVLVGYSQGGEIMDVALCGGGDPNQGYTNTAVQLSSSAVNMVKAAIFMGDPMFRAGLSYEVGTCAAGGFDQRPAGFSCPSAAKIKSYCDASDPYCCNGSNAATHQGYGSEYGSQALAFVKSKLG'],
        ['AXE2_TALPU', 'reference', 'MHSKFFAASLLGLGAAAIPLEGVMEKRSCPAIHVFGARETTASPGYGSSSTVVNGVLSAYPGSTAEAINYPACGGQSSCGGASYSSSVAQGIAAVASAVNSFNSQCPSTKIVLVGYSQGGEIMDVALCGGGDPNQGYTNTAVQLSSSAVNMVKAAIFMGDPMFRAGLSYEVGTCAAGGFDQRPAGFSCPSAAKIKSYCDASDPYCCNGSNAATHQGYGSEYGSQALAFVKSKLG'],
        ['AXE2_GEOSE', 'reference', 'MKIGSGEKLLFIGDSITDCGRARPEGEGSFGALGTGYVAYVVGLLQAVYPELGIRVVNKGISGNTVRDLKARWEEDVIAQKPDWVSIMIGINDVWRQYDLPFMKEKHVYLDEYEATLRSLVLETKPLVKGIILMTPFYIEGNEQDPMRRTMDQYGRVVKQIAEETNSLFVDTQAAFNEVLKTLYPAALAWDRVHPSVAGHMILARAFLREIGFEWVRSR'], 
        ['AXE7A_XYLR2', 'referece', 'MFNFAPKQTTEMKKLLFTLVFVLGSMATALAENYPYRADYLWLTVPNHADWLYKTGERAKVEVSFCLYGMPQNVEVAYEIGPDMMPATSSGKVTLKNGRAVIDMGTMKKPGFLDMRLSVDGKYQHHVKVGFSPELLKPYTKNPQDFDAFWKANLDEARKTPVSVSCNKVDKYTTDAFDCYLLKIKTDRRHSIYGYLTKPKKAGKYPVVLCPPGAGIKTIKEPMRSTFYAKNGFIRLEMEIHGLNPEMTDEQFKEITTAFDYENGYLTNGLDDRDNYYMKHVYVACVRAIDYLTSLPDWDGKNVFVQGGSQGGALSLVTAGLDPRVTACVANHPALSDMAGYLDNRAGGYPHFNRLKNMFTPEKVNTMAYYDVVNFARRITCPVYITWGYNDNVCPPTTSYIVWNLITAPKESLITPINEHWTTSETNYTQMLWLKKQVK'], 
        ['A0A0B8RHP0_LISMN', 'reference', 'MKKLLFLGDSVTDAGRDFENDRELGHGYVKIIADQLEQEDVTVINRGVSANRVADLHRRIEADAISLQPDVVTIMIGINDTWFSFSRWEDTSVTAFKEVYRVILNRIKTETNAELILMEPFVLPYPEDRKEWRGDLDPKIGAVRELAAEFGATLIPLDGLMNALAIKHGPTFLAEDGVHPTKAGHEAIASTWLEFTK']]
df = pd.DataFrame(rows, columns=[id_col, label_col, seq_col])
df << (ClustalOmega(id_col, seq_col) >> Save('tmp/clustalomega_test.pkl'))

CREEP

CREEP is a tool for predicting the EC number of a reaction. At the moment it only supports reactions to EC however we are extending this to other modalities.

from enzymetk.annotateEC_CREEP_step import CREEP
from enzymetk.save_step import Save
import pandas as pd

# CREEP expects you to have downloaded the data from the zotero page and put it in the data/CREEP folder
output_dir = 'tmp/'
df = pd.DataFrame({'EC number': ['1.1.1.1', '1.1.1.2'], 
                   'Sequence': ['MALWMRLLPLLALLALWGPDPAAA', 'MALWMRLLPLLALLALWGPDPAAA'], 
                   'Reaction': ['O=P(OC1=CC=CC=C1)(OC2=CC=CC=C2)OC3=CC=CC=C3>>O=P(O)(OC4=CC=CC=C4)OC5=CC=CC=C5.OC6=CC=CC=C6',
                                'O=P(OC1=CC=CC=C1)(OC2=CC=CC=C2)OC3=CC=CC=C3>>O=P(O)(OC4=CC=CC=C4)OC5=CC=CC=C5.OC6=CC=CC=C6']})
id_col = 'Entry'
reaction_col = 'Reaction'

df << (CREEP(id_col, reaction_col, CREEP_cache_dir='/disk1/share/software/CREEP/data/', CREEP_dir='/disk1/share/software/CREEP/',
            modality='reaction', reference_modality='protein') >> Save(f'{output_dir}CREEP_test_protein.pkl'))

EmbedESM

EmbedESM is a tool for embedding a set of sequences using ESM2.

from enzymetk.embedprotein_esm_step import EmbedESM
from enzymetk.save_step import Save
import pandas as pd

id_col = 'Entry'
seq_col = 'Sequence'
label_col = 'ActiveSite'
rows = [['AXE2_TALPU', '10', 'MHSKFFAASLLGLGAAAIPLEGVMEKRSCPAIHVFGARETTASPGYGSSSTVVNGVLSAYPGSTAEAINYPACGGQSSCGGASYSSSVAQGIAAVASAVNSFNSQCPSTKIVLVGYSQGGEIMDVALCGGGDPNQGYTNTAVQLSSSAVNMVKAAIFMGDPMFRAGLSYEVGTCAAGGFDQRPAGFSCPSAAKIKSYCDASDPYCCNGSNAATHQGYGSEYGSQALAFVKSKLG'],
        ['AXE2_GEOSE', '1|2', 'MKIGSGEKLLFIGDSITDCGRARPEGEGSFGALGTGYVAYVVGLLQAVYPELGIRVVNKGISGNTVRDLKARWEEDVIAQKPDWVSIMIGINDVWRQYDLPFMKEKHVYLDEYEATLRSLVLETKPLVKGIILMTPFYIEGNEQDPMRRTMDQYGRVVKQIAEETNSLFVDTQAAFNEVLKTLYPAALAWDRVHPSVAGHMILARAFLREIGFEWVRSR'], 
        ['AXE7A_XYLR2', '1', 'MFNFAPKQTTEMKKLLFTLVFVLGSMATALAENYPYRADYLWLTVPNHADWLYKTGERAKVEVSFCLYGMPQNVEVAYEIGPDMMPATSSGKVTLKNGRAVIDMGTMKKPGFLDMRLSVDGKYQHHVKVGFSPELLKPYTKNPQDFDAFWKANLDEARKTPVSVSCNKVDKYTTDAFDCYLLKIKTDRRHSIYGYLTKPKKAGKYPVVLCPPGAGIKTIKEPMRSTFYAKNGFIRLEMEIHGLNPEMTDEQFKEITTAFDYENGYLTNGLDDRDNYYMKHVYVACVRAIDYLTSLPDWDGKNVFVQGGSQGGALSLVTAGLDPRVTACVANHPALSDMAGYLDNRAGGYPHFNRLKNMFTPEKVNTMAYYDVVNFARRITCPVYITWGYNDNVCPPTTSYIVWNLITAPKESLITPINEHWTTSETNYTQMLWLKKQVK'], 
        ['A0A0B8RHP0_LISMN', '2', 'MKKLLFLGDSVTDAGRDFENDRELGHGYVKIIADQLEQEDVTVINRGVSANRVADLHRRIEADAISLQPDVVTIMIGINDTWFSFSRWEDTSVTAFKEVYRVILNRIKTETNAELILMEPFVLPYPEDRKEWRGDLDPKIGAVRELAAEFGATLIPLDGLMNALAIKHGPTFLAEDGVHPTKAGHEAIASTWLEFTK']]
df = pd.DataFrame(rows, columns=[id_col, label_col, seq_col])
df << (EmbedESM(id_col, seq_col, extraction_method='mean', tmp_dir='tmp/') >> Save('tmp/esm2_test.pkl'))
# You can also extract the active site embedding in addition to the mean embedding
df << (EmbedESM(id_col, seq_col, extraction_method='active_site', active_site_col='ActiveSite', tmp_dir='tmp/') >> Save('tmp/esm2_test_active_site.pkl'))

FoldSeek

See: FoldSeek

FoldSeek does a similarity search against a database of structures, it runs in the enzyme-tk environment. Similarly to the diamond blast, you can either create databases yourself before hand using the foldseek documentation or you can create a database on the fly by passing the dataframe with a column called label that has two values: reference and query. If you pass a database, you need to pass the path to the database.

The columns expect a path to a pdb file i.e. the output from the Chai step.

from enzymetk.similarity_foldseek_step import FoldSeek
from enzymetk.save_step import Save
import pandas as pd

# id_col: str, seq_col: str, proteinfer_dir: str,
output_dir = 'tmp/'
rows = [['tmp/P0DP24/chai/P0DP24_3.cif'],
        ['tmp/P0DP24/chai/P0DP24_1.cif']]
df = pd.DataFrame(rows, columns=['pdbs'])
# foldseek_dir: str, pdb_column_name: str, reference_database: str
pdb_column_name = 'pdbs'
# The foldseek database was created using the folldwing command in this location:
# foldseek databases PDB pdb tmp 
reference_database = '/disk1/share/software/foldseek/structures/pdb/pdb'
df << (FoldSeek(pdb_column_name, reference_database) >> Save(f'{output_dir}pdb_files.pkl'))

LigandMPNN

LigandMPNN is a tool for inpainting the sequence for a protein backbone that has been generated by a generative model.

See: LigandMPNN

from steps.inpaint_ligandMPNN_step import LigandMPNN
from steps.save_step import Save
import pandas as pd

# id_col: str, seq_col: str, proteinfer_dir: str,
# This needs to be the full path to the file since LigandMPNN requires the full path (otherwise it will save to the ligandmpnn directory)
output_dir = '/disk1/ariane/vscode/enzyme-tk/examples/tmp/'
# These have to be the full path to the file since LigandMPNN requires the full path.
rows = [['/disk1/ariane/vscode/enzyme-tk/examples/tmp/P0DP24/chai/P0DP24_3.cif'],
        ['/disk1/ariane/vscode/enzyme-tk/examples/tmp/P0DP24/chai/P0DP24_1.cif']]
df = pd.DataFrame(rows, columns=['pdbs'])
# foldseek_dir: str, pdb_column_name: str, reference_database: str
pdb_column_name = 'pdbs'
ligand_mpnn_dir = '/disk1/share/software/LigandMPNN/'
# See how you need to enclose the fixed residues in quotes make sure any spaces are closed in double quotes!
args = ['--fixed_residues', '"A19 A20 A21 A59 A60 A61 A90 A91 A92"', '--checkpoint_path_sc', f'{ligand_mpnn_dir}model_params/ligandmpnn_sc_v_32_002_16.pt']
df << (LigandMPNN(pdb_column_name, ligand_mpnn_dir, output_dir,args=args) >> Save(f'{output_dir}ligandmpnn_inpainted.pkl'))

Proteinfer

Proteinfer is a tool for predicting the EC number of an enzyme.

output_dir = 'tmp/'
num_threads = 1
id_col = 'Entry'
seq_col = 'Sequence'
substrate_col = 'Substrate'
rows = [['P0DP23', 'MALWMRLLPLLALLALWGPDPAAAMALWMRLLPLLALLALWGPDPAAAMALWMRLLPLLALLALWGPDPAAA', 'CCCCC(CC)COC(=O)C1=CC=CC=C1C(=O)OCC(CC)CCCC'], 
        ['AXE2', 'MKIGSGEKLLFIGDSITDCGRARPEGEGSFGALGTGYVAYVVGLLQAVYPELGIRVVNKGISGNTVRDLKARWEEDVIAQKPDWVSIMIGINDVWRQYDLPFMKEKHVYLDEYEATLRSLVLETKPLVKGIILMTPFYIEGNEQDPMRRTMDQYGRVVKQIAEETNSLFVDTQAAFNEVLKTLYPAALAWDRVHPSVAGHMILARAFLREIGFEWVRSR', 'CCCCC(CC)COC(=O)C1=CC=CC=C1C(=O)OCC(CC)CCCC']]
df = pd.DataFrame(rows, columns=[id_col, seq_col, substrate_col])
# This should be relative to the location of the script if you installed via the install_all.sh script
# Note you need to have downloaded their predictive models (ToDo )
proteinfer_dir = 'software/proteinfer/'
df << (ProteInfer(id_col, seq_col, proteinfer_dir, num_threads=num_threads) >> Save(f'proteinfer.pkl'))

Tools and references

Being a toolkit this is a collection of other tools, which means if you use any of these tools then cite the ones relevant to your work:

mmseqs2
foldseek
diamond
proteinfer
CLEAN
chai
chemBERTa2
SELFormer
rxnfp
clustalomega
CREEP
esm
LigandMPNN
vina
Uni-Mol
fasttree
Porechop
prokka

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

enzymetk-0.0.2.tar.gz (33.5 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

enzymetk-0.0.2-py3-none-any.whl (45.7 kB view details)

Uploaded Python 3

File details

Details for the file enzymetk-0.0.2.tar.gz.

File metadata

  • Download URL: enzymetk-0.0.2.tar.gz
  • Upload date:
  • Size: 33.5 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/6.1.0 CPython/3.10.14

File hashes

Hashes for enzymetk-0.0.2.tar.gz
Algorithm Hash digest
SHA256 c8e3f9257c0ae8662ba072a89bef120c3a08773417b9f081974f4ec71b8a6646
MD5 ddf95623958fa14935f7311942fc41fe
BLAKE2b-256 416a1b2cc2c9584755acdb3d68474afe6c97e0bc6ab430a3f0fa9f4526ab8d38

See more details on using hashes here.

File details

Details for the file enzymetk-0.0.2-py3-none-any.whl.

File metadata

  • Download URL: enzymetk-0.0.2-py3-none-any.whl
  • Upload date:
  • Size: 45.7 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/6.1.0 CPython/3.10.14

File hashes

Hashes for enzymetk-0.0.2-py3-none-any.whl
Algorithm Hash digest
SHA256 aa03e9d1fc5ab12bf18d5dac2fb66602bbe3a72c394eb37c989ca21cb2687a2f
MD5 3948ad20c56deb9d706d5ae5d3a77b69
BLAKE2b-256 44015f8e45277b9cbbfc79562e33eea444a5e11744b5844396c7d9fb896bbbf3

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page