Skip to main content

EvolutionaryScale open model repository

Project description

ESM

ESM3ESM CSlackTutorials

This repository contains flagship protein models for EvolutionaryScale, as well as access to the API. ESM3 is our flagship multimodal protein generative model, and can be used for generation and prediction tasks. ESM C is our best protein representation learning model, and can be used to embed protein sequences.

Installation

To get started with ESM, install the python library using pip:

pip install esm

Available Models

ESM 3 Family

Model Model Size Release Date Note
Flagship Models Most users will be interested in using one of these models.
esm3-large-2024-03 98B 2024-03
esm3-medium-2024-08 7B 2024-08
esm3-small-2024-08 1.4B 2024-08
Published Models These models were used to generate all of the results in the ESM3 paper and are provided to facilitate reproducibility.
esm3-large-2024-03 98B 2024-03
esm3-medium-2024-03 7B 2024-03
esm3-small-2024-03 1.4B 2024-03
Experimental Models These models are provided for early use by researchers and are still under development.
esm3-medium-multimer-2024-09 7B 2024-09

ESM C Models

Model Model Size Number of Layers Release Date
esmc-6b-2024-12 6B 80 2024-12
esmc-600m-2024-12 600M 36 2024-12
esmc-300m-2024-12 300M 30 2024-12

ESM 3

ESM3 is a frontier generative model for biology, able to jointly reason across three fundamental biological properties of proteins: sequence, structure, and function. These three data modalities are represented as tracks of discrete tokens at the input and output of ESM3. You can present the model with a combination of partial inputs across the tracks, and ESM3 will provide output predictions for all the tracks.

ESM3 is a generative masked language model. You can prompt it with partial sequence, structure, and function keywords, and iteratively sample masked positions until all positions are unmasked. This iterative sampling is what the .generate() function does.

ESM3 Diagram

The ESM3 architecture is highly scalable due to its transformer backbone and all-to-all reasoning over discrete token sequences. At its largest scale, ESM3 was trained with 1.07e24 FLOPs on 2.78 billion proteins and 771 billion unique tokens, and has 98 billion parameters. Learn more by reading the blog post and the paper (Hayes et al., 2024).

ESM3-open, with 1.4B parameters, is the smallest and fastest model in the family.

Quickstart for ESM3-open

The weights are stored on HuggingFace Hub under HuggingFace/EvolutionaryScale/esm3.

from huggingface_hub import login
from esm.models.esm3 import ESM3
from esm.sdk.api import ESM3InferenceClient, ESMProtein, GenerationConfig

# Will instruct you how to get an API key from huggingface hub, make one with "Read" permission.
login()

# This will download the model weights and instantiate the model on your machine.
model: ESM3InferenceClient = ESM3.from_pretrained("esm3-open").to("cuda") # or "cpu"

# Generate a completion for a partial Carbonic Anhydrase (2vvb)
prompt = "___________________________________________________DQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPP___________________________________________________________"
protein = ESMProtein(sequence=prompt)
# Generate the sequence, then the structure. This will iteratively unmask the sequence track.
protein = model.generate(protein, GenerationConfig(track="sequence", num_steps=8, temperature=0.7))
# We can show the predicted structure for the generated sequence.
protein = model.generate(protein, GenerationConfig(track="structure", num_steps=8))
protein.to_pdb("./generation.pdb")
# Then we can do a round trip design by inverse folding the sequence and recomputing the structure
protein.sequence = None
protein = model.generate(protein, GenerationConfig(track="sequence", num_steps=8))
protein.coordinates = None
protein = model.generate(protein, GenerationConfig(track="structure", num_steps=8))
protein.to_pdb("./round_tripped.pdb")

Congratulations, you just generated your first proteins with ESM3!

EvolutionaryScale Forge: Access to larger ESM3 models

You can access all scales of ESM3 models EvolutionaryScale Forge.

We encourage users to interact with the Forge API through the python esm library instead of the command line. The python interface enables you to interactively load proteins, build prompts, and inspect generated proteins with the ESMProtein and config classes used to interact with the local model.

In any example script you can replace a local ESM3 model with a Forge API client:

# Instead of loading the model locally on your machine:
model: ESM3InferenceClient = ESM3.from_pretrained("esm3_sm_open_v1").to("cuda") # or "cpu"
# just replace the line with this:
model: ESM3InferenceClient = esm.sdk.client("esm3-medium-2024-08", token="<your forge token>")
# and now you're interfacing with the model running on our remote servers.
...

and the exact same code will work. This enables a seamless transition from smaller and faster models, to our largest and most capable protein language models for protein design work.

Async Forge Client

The Forge client supports asynchronous API calls for improved performance when making multiple requests. Async methods follow the same naming convention as their synchronous counterparts, with async_ prepended to the method name. For example:

model = esm.sdk.client("esm3-medium-2024-08", token="<your forge token>")

protein = await model.async_generate(protein, GenerationConfig(track="sequence"))

ESM3 Example Usage

Generating a novel GFP with chain of thought generation using ESM3 Open In Colab

Advanced prompting with ESM3 input tracks Open In Colab

ESM C

ESM Cambrian is a parallel model family to our flagship ESM3 generative models. While ESM3 focuses on controllable generation of proteins, ESM C focuses on creating representations of the underlying biology of proteins.

ESM C is designed as a drop-in replacement for ESM2 and comes with major performance benefits. The 300M parameter ESM C delivers similar performance to ESM2 650M with dramatically reduced memory requirements and faster inference. The 600M parameter ESM C rivals the 3B parameter ESM2 and approaches the capabilities of the 15B model, delivering frontier performance with far greater efficiency. The 6B parameter ESM C outperforms the best ESM2 models by a wide margin.

ESM C can be run locally, via the Forge API or through AWS SageMaker.

Quickstart for ESM C Open Models

When running the code below, a pytorch model will be instantiated locally on your machine, with the weights downloaded from the HuggingFace hub.

from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein, LogitsConfig

protein = ESMProtein(sequence="AAAAA")
client = ESMC.from_pretrained("esmc_300m").to("cuda") # or "cpu"
protein_tensor = client.encode(protein)
logits_output = client.logits(
   protein_tensor, LogitsConfig(sequence=True, return_embeddings=True)
)
print(logits_output.logits, logits_output.embeddings)

To use Flash Attention with the open weights:

Simply install flash-attn package, which will enable Flash Attention automatically:

pip install flash-attn --no-build-isolation

You can also disable flash-attn by passing use_flash_attn=False to utils like ESMC_300M_202412.

ESM C 6B via Forge API

Apply for access and copy the API token from the console by first visiting Forge.

With the code below, a local python client talks to the model inference server hosted by EvolutionaryScale.

from esm.sdk.forge import ESM3ForgeInferenceClient
from esm.sdk.api import ESMProtein, LogitsConfig

# Apply for forge access and get an access token
forge_client = ESM3ForgeInferenceClient(model="esmc-6b-2024-12", url="https://forge.evolutionaryscale.ai", token="<your forge token>")
protein_tensor = forge_client.encode(protein)
logits_output = forge_client.logits(
   protein_tensor, LogitsConfig(sequence=True, return_embeddings=True)
)
print(logits_output.logits, logits_output.embeddings)

Remember to replace <your forge token> with your actual Forge access token.

Forge Batch Executor

For jobs that require processing multiple inputs, the Forge Batch Executor provides a streamlined and way to execute them concurrently and efficiently while respecting rate limits and adapting to request latency.

from esm.sdk.forge import ESM3ForgeInferenceClient
from esm.sdk.api import ESMProtein, LogitsConfig
from esm.sdk import batch_executor

def embed_sequence(client: ESM3ForgeInferenceClient, sequence: str) -> LogitsOutput:
    protein = ESMProtein(sequence=sequence)
    protein_tensor = client.encode(protein)
    if isinstance(protein_tensor, ESMProteinError):
        raise protein_tensor
    output = client.logits(protein_tensor, LogitsConfig(sequence=True, return_embeddings=True))
    return output

sequences = ["A", "AA", "AAA"]
client =  ESM3ForgeInferenceClient(model="esmc-6b-2024-12", url="https://forge.evolutionaryscale.ai", token="<your forge token>")

# Usage Example:
# To execute a batch job, wrap your function inside the batch executor context manager.
# Syntax:
# with batch_executor() as executor:
#     outputs = executor.execute_batch(user_func=<your_function>, **kwargs)

with batch_executor() as executor:
    outputs = executor.execute_batch(user_func=embed_sequence, client=client, sequence=sequences)

ESM C via SageMaker for Commercial Use

ESM C models are also available on Amazon SageMaker under the Cambrian Inference Clickthrough License Agreement. Under this license agreement, models are available for broad use for commercial entities.

You will need an admin AWS access to an AWS account to follow these instructions. To deploy, first we need to deploy the AWS package:

  1. Find the ESM C model version you want to subscribe to. All of our offerings are visible here.
  2. Click the name of the model version you are interested in, review pricing information and the end user license agreement (EULA), then click "Continue to Subscribe".
  3. Once you have subscribed, you should be able to see our model under your marketplace subscriptions.
  4. Click the product name and then from the "Actions" dropdown select "Configure".
  5. You will next see the "Configure and Launch" UI. There are multiple deployment paths - we recommend using "AWS CloudFormation".
  6. The default value for "Service Access" may or may not work. We recommend clicking "Create and use a new service role".
  7. Click "Launch CloudFormation Template". This takes 15 to 25 minutes depending on model size.
  8. On the "Quick create stack" page, ensure the stack name and endpoint names are not already used. You can check existing stack names here and existing endpoint names here.

The SageMaker deployment of the model now lives on a dedicated GPU instance inside your AWS environment, and will be billed directly to your AWS account. Make sure to remember to shut down the instance after you stop using it. Find the CloudFormation stack you created here, select it, and then click "Delete" to clean up all resources.

After creating the endpoint, you can create a SageMaker client and use it the same way as a Forge client. They share the same API. The local python client talks to the SageMaker endpoint you just deployed, which runs on an instance with a GPU to run model inference.

Ensure that the code below runs in an environment that has AWS credentials available for the account which provisioned SageMaker resources. Learn more about general AWS credential options here.

from esm.sdk.sagemaker import ESM3SageMakerClient
from esm.sdk.api import ESMProtein, LogitsConfig

sagemaker_client = ESM3SageMakerClient(
   # E.g. "Endpoint-ESMC-6B-1"
   endpoint_name=SAGE_ENDPOINT_NAME,
   # E.g. "esmc-6b-2024-12". Same model names as in Forge.
   model=MODEL_NAME,
)

protein = ESMProtein(sequence="AAAAA")
protein_tensor = sagemaker_client.encode(protein)
logits_output = sagemaker_client.logits(
   protein_tensor, LogitsConfig(sequence=True, return_embeddings=True)
)
print(logits_output.logits, logits_output.embeddings)

ESM C Example Usage

Embedding a sequence using ESM C Open In Colab

Responsible Development

EvolutionaryScale is a public benefit company. Our mission is to develop artificial intelligence to understand biology for the benefit of human health and society, through partnership with the scientific community, and open, safe, and responsible research. Inspired by the history of our field as well as new principles and recommendations, we have created a Responsible Development Framework to guide our work towards our mission with transparency and clarity.

The core tenets of our framework are

  • We will communicate the benefits and risks of our research
  • We will proactively and rigorously evaluate the risk of our models before public deployment
  • We will adopt risk mitigation strategies and precautionary guardrails
  • We will work with stakeholders in government, policy, and civil society to keep them informed

With this in mind, we have performed a variety of mitigations for esm3-sm-open-v1, detailed in our paper

Licenses

The code and model weights of ESM3 and ESM C are available under a mixture of non-commercial and permissive commercial licenses. For complete license details, see LICENSE.md.

Citations

If you use ESM in your work, please cite one of the following:

ESM3

@article {hayes2024simulating,
	author = {Hayes, Thomas and Rao, Roshan and Akin, Halil and Sofroniew, Nicholas J. and Oktay, Deniz and Lin, Zeming and Verkuil, Robert and Tran, Vincent Q. and Deaton, Jonathan and Wiggert, Marius and Badkundri, Rohil and Shafkat, Irhum and Gong, Jun and Derry, Alexander and Molina, Raul S. and Thomas, Neil and Khan, Yousuf A. and Mishra, Chetan and Kim, Carolyn and Bartie, Liam J. and Nemeth, Matthew and Hsu, Patrick D. and Sercu, Tom and Candido, Salvatore and Rives, Alexander},
	title = {Simulating 500 million years of evolution with a language model},
	year = {2025},
	doi = {10.1126/science.ads0018},
	URL = {http://dx.doi.org/10.1126/science.ads0018},
	journal = {Science}
}

ESM C

@misc{esm2024cambrian,
  author = {{ESM Team}},
  title = {ESM Cambrian: Revealing the mysteries of proteins with unsupervised learning},
  year = {2024},
  publisher = {EvolutionaryScale Website},
  url = {https://evolutionaryscale.ai/blog/esm-cambrian},
  urldate = {2024-12-04}
}

ESM Github (Code / Weights)

@software{evolutionaryscale_2024,
  author = {{EvolutionaryScale Team}},
  title = {evolutionaryscale/esm},
  year = {2024},
  publisher = {Zenodo},
  doi = {10.5281/zenodo.14219303},
  URL = {https://doi.org/10.5281/zenodo.14219303}
}

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distributions

No source distribution files available for this release.See tutorial on generating distribution archives.

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

esm-3.2.3-py3-none-any.whl (2.5 MB view details)

Uploaded Python 3

File details

Details for the file esm-3.2.3-py3-none-any.whl.

File metadata

  • Download URL: esm-3.2.3-py3-none-any.whl
  • Upload date:
  • Size: 2.5 MB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/6.1.0 CPython/3.12.9

File hashes

Hashes for esm-3.2.3-py3-none-any.whl
Algorithm Hash digest
SHA256 61847d25b80efe0121931609b5ea885cc142ceb8caaa22ead6e3e97c527bc2af
MD5 1111cdb4d41dc1a41b6a55aa4620238c
BLAKE2b-256 b9e6d2ac74ec2ad695073ca49f0e9887ce9c47302578af05dbe39b099a7c0af5

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page