Skip to main content

PyPI - Version tests workflow OS DOI

fastapy

A lightweight Python package to read and write sequence records in FASTA format.

The design was inspired by the utility of BioPython’s SeqIO, which supports many sequence formats. This repo focuses only on FASTA records. It is faster than BioPython, can handle compressed FASTA files (gzip, bzip2, zip), and has no Python package dependencies.

Requirements

Python >= 3.8

Installation

You can install fastapy from PyPI:

pip install fastapy

or directly from GitHub:

pip install "git+https://github.com/aziele/fastapy.git"

You can also use fastapy without installation since it doesn't have any dependencies. Simply clone or download this repository and you're ready to use it.

git clone https://github.com/aziele/fastapy.git
cd fastapy
python
>>> import fastapy
>>> fastapy.__doc__
'A lightweight Python module to read and write FASTA sequence records'

Quick Start

Typical usage is to read a FASTA file and loop over the sequences record(s).

import fastapy

for record in fastapy.parse('tests/test.fasta'):
    print(record.id, len(record), record.seq[:10], record.desc)

Output:

NP_002433.1  362   METDAPQPGL   RNA-binding protein Musashi homolog 1 [Homo sapiens]
ENO94161.1    79   MKLLISGLGP   RRM domain-containing RNA-binding protein
sequence     292   MKLSKIALMM

Usage

This module contains the Record class representing a FASTA sequence record and the parse() function to read FASTA records from a file.

Record object

Record is an object that contains information on a FASTA sequence record, including id, description, and the sequence itself.

import fastapy

record = fastapy.Record(
    id='NP_950171.2', 
    seq='MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFASICRKRQE',
    desc='APITD1-CORT protein isoform 2 [Homo sapiens]'
)

print(record.id)            # NP_950171.2
print(record.desc)          # APITD1-CORT protein isoform 2 [Homo sapiens]
print(record.seq)           # MEEEAE..
print(record.description)   # >NP_950171.2 G APITD1-CORT protein isoform 2 [Homo sapiens]
print(len(record))          # 77
print('EEEA' in record)     # True

By default, the sequence line is wrapped to 70 characters. You can provide the line length. Use zero (or None) for no wrapping.

print(record)
# >NP_950171.2 APITD1-CORT protein isoform 2 [Homo sapiens]
# MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFAS
# ICRKRQE

print(record.format(wrap=30))
# >NP_001382951.1 G protein subunit gamma 5 [Homo sapiens]
# MEEEAETEEQQRFSYQQRLKAAVHYTVGCL
# CEEVALDKEMQFSKQTIAAISELTFRQCEN
# FAKDLEMFASICRKRQE

print(record.format(wrap=None))
# >NP_950171.2 APITD1-CORT protein isoform 2 [Homo sapiens]
# MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFASICRKRQE

parse

The parse() function is a generator to read FASTA records as Record objects one by one from a file (plain FASTA or compressed using gzip or bzip2). Because only one record is created at a time, very little memory is required.

import fastapy

for record in fastapy.parse('tests/test.fasta.gz'):
    print(record.id)

For some tasks you may need to have a reusable access to the records. For this purpose, you can use the built-in Python list() function to turn the iterator into a list:

import fastapy

records = list(fastapy.parse('tests/test.fasta.gz'))
print(records[0].id)   # First record
print(records[-1].id)  # Last record

Another common task is to index your records by sequence identifier. Use to_dict() to turn a Record iterator (or list) into a dictionary.

import fastapy

records = fastapy.to_dict(fasta.parse('tests/test.fasta.gz'))
print(records['NP_002433.1'])   # Use any record id

read

The read() function reads only the first FASTA record from a file. It does not read any subsequent records in the file.

import fastapy

seq_record = fastapy.read('tests/test.fasta')
print(seq_record.id)           # NP_002433.1

Test

You can run tests to ensure that the module works as expected.

python -m unittest discover

License

GNU General Public License, version 3

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

fastapy-1.0.5.tar.gz (45.2 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

fastapy-1.0.5-py3-none-any.whl (30.4 kB view details)

Uploaded Python 3

File details

Details for the file fastapy-1.0.5.tar.gz.

File metadata

  • Download URL: fastapy-1.0.5.tar.gz
  • Upload date:
  • Size: 45.2 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/5.1.1 CPython/3.12.6

File hashes

Hashes for fastapy-1.0.5.tar.gz
Algorithm Hash digest
SHA256 55ef76b0ded9071420023d64ca52f857b891db85157afe3e8be7b0f7ea027f1b
MD5 14170bf4a0883fc951bfe80f77b6243a
BLAKE2b-256 a1034b542f0a001849baf3a861d7ff961c006f50709b160efeeb1bba95467550

See more details on using hashes here.

File details

Details for the file fastapy-1.0.5-py3-none-any.whl.

File metadata

  • Download URL: fastapy-1.0.5-py3-none-any.whl
  • Upload date:
  • Size: 30.4 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/5.1.1 CPython/3.12.6

File hashes

Hashes for fastapy-1.0.5-py3-none-any.whl
Algorithm Hash digest
SHA256 214749fc6d945e435533ca920c81e823f050aa56538b5e4bfde2e276c3a69c06
MD5 fc30e87eaa651e5b5f24b8ef2f6e02c6
BLAKE2b-256 0eda6ab3aa39edb30857b576548189e1b1ba4114922f8a1694151c0154e1f9d0

See more details on using hashes here.

Release history Release notifications | RSS feed

This release

1.0.5 This release

2 files

1.0.4

2 files

1.0.3

2 files

1.0.2

2 files

1.0.1

2 files

Anthropic, PBC Visionary sponsor Bloomberg Visionary sponsor Hudson River Trading Visionary sponsor Meta Visionary sponsor NVIDIA Visionary sponsor Microsoft Sustainability sponsor Depot Continuous Integration AWS Cloud computing and Security Sponsor Datadog Monitoring Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page