Skip to main content

Fast, light, accurate library for biological sequence embeddings (proteins, DNA, RNA)

Project description

⚡️ What is FastEmbed?

FastEmbed is a lightweight, fast, Python library built for embedding generation. We support popular text models. Please open a GitHub issue if you want us to add a new model.

The default text embedding (TextEmbedding) model is Flag Embedding, presented in the MTEB leaderboard. It supports "query" and "passage" prefixes for the input text. Here is an example for Retrieval Embedding Generation and how to use FastEmbed with Qdrant.

📈 Why FastEmbed?

  1. Light: FastEmbed is a lightweight library with few external dependencies. We don't require a GPU and don't download GBs of PyTorch dependencies, and instead use the ONNX Runtime. This makes it a great candidate for serverless runtimes like AWS Lambda.

  2. Fast: FastEmbed is designed for speed. We use the ONNX Runtime, which is faster than PyTorch. We also use data parallelism for encoding large datasets.

  3. Accurate: FastEmbed is better than OpenAI Ada-002. We also support an ever-expanding set of models, including a few multilingual models.

🚀 Installation

To install the FastEmbed library, pip works best. You can install it with or without GPU support:

pip install fastembed

# or with GPU support

pip install fastembed-gpu

📖 Quickstart

from fastembed import TextEmbedding


# Example list of documents
documents: list[str] = [
    "This is built to be faster and lighter than other embedding libraries e.g. Transformers, Sentence-Transformers, etc.",
    "fastembed is supported by and maintained by Qdrant.",
]

# This will trigger the model download and initialization
embedding_model = TextEmbedding()
print("The model BAAI/bge-small-en-v1.5 is ready to use.")

embeddings_generator = embedding_model.embed(documents)  # reminder this is a generator
embeddings_list = list(embedding_model.embed(documents))
  # you can also convert the generator to a list, and that to a numpy array
len(embeddings_list[0]) # Vector of 384 dimensions

Fastembed supports a variety of models for different tasks and modalities. The list of all the available models can be found here

🎒 Dense text embeddings

from fastembed import TextEmbedding

model = TextEmbedding(model_name="BAAI/bge-small-en-v1.5")
embeddings = list(model.embed(documents))

# [
#   array([-0.1115,  0.0097,  0.0052,  0.0195, ...], dtype=float32),
#   array([-0.1019,  0.0635, -0.0332,  0.0522, ...], dtype=float32)
# ]

Dense text embedding can also be extended with models which are not in the list of supported models.

from fastembed import TextEmbedding
from fastembed.common.model_description import PoolingType, ModelSource

TextEmbedding.add_custom_model(
    model="intfloat/multilingual-e5-small",
    pooling=PoolingType.MEAN,
    normalization=True,
    sources=ModelSource(hf="intfloat/multilingual-e5-small"),  # can be used with an `url` to load files from a private storage
    dim=384,
    model_file="onnx/model.onnx",  # can be used to load an already supported model with another optimization or quantization, e.g. onnx/model_O4.onnx
)
model = TextEmbedding(model_name="intfloat/multilingual-e5-small")
embeddings = list(model.embed(documents))

🔱 Sparse text embeddings

  • SPLADE++
from fastembed import SparseTextEmbedding

model = SparseTextEmbedding(model_name="prithivida/Splade_PP_en_v1")
embeddings = list(model.embed(documents))

# [
#   SparseEmbedding(indices=[ 17, 123, 919, ... ], values=[0.71, 0.22, 0.39, ...]),
#   SparseEmbedding(indices=[ 38,  12,  91, ... ], values=[0.11, 0.22, 0.39, ...])
# ]

🦥 Late interaction models (aka ColBERT)

from fastembed import LateInteractionTextEmbedding

model = LateInteractionTextEmbedding(model_name="colbert-ir/colbertv2.0")
embeddings = list(model.embed(documents))

# [
#   array([
#       [-0.1115,  0.0097,  0.0052,  0.0195, ...],
#       [-0.1019,  0.0635, -0.0332,  0.0522, ...],
#   ]),
#   array([
#       [-0.9019,  0.0335, -0.0032,  0.0991, ...],
#       [-0.2115,  0.8097,  0.1052,  0.0195, ...],
#   ]),  
# ]

🖼️ Image embeddings

from fastembed import ImageEmbedding

images = [
    "./path/to/image1.jpg",
    "./path/to/image2.jpg",
]

model = ImageEmbedding(model_name="Qdrant/clip-ViT-B-32-vision")
embeddings = list(model.embed(images))

# [
#   array([-0.1115,  0.0097,  0.0052,  0.0195, ...], dtype=float32),
#   array([-0.1019,  0.0635, -0.0332,  0.0522, ...], dtype=float32)
# ]

🧬 Protein embeddings

from fastembed import ProteinEmbedding

sequences = [
    "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
    "GKGDPKKPRGKMSSYAFFVQTSREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAK",
]

model = ProteinEmbedding(model_name="facebook/esm2_t12_35M_UR50D")
embeddings = list(model.embed(sequences))

# [
#   array([-0.0055, -0.0144,  0.0355, -0.0049, ...], dtype=float32),
#   array([ 0.0114,  0.0020, -0.0247,  0.0060, ...], dtype=float32)
# ]

Late interaction multimodal models (ColPali)

from fastembed import LateInteractionMultimodalEmbedding

doc_images = [
    "./path/to/qdrant_pdf_doc_1_screenshot.jpg",
    "./path/to/colpali_pdf_doc_2_screenshot.jpg",
]

query = "What is Qdrant?"

model = LateInteractionMultimodalEmbedding(model_name="Qdrant/colpali-v1.3-fp16")
doc_images_embeddings = list(model.embed_image(doc_images))
# shape (2, 1030, 128)
# [array([[-0.03353882, -0.02090454, ..., -0.15576172, -0.07678223]], dtype=float32)]
query_embedding = model.embed_text(query)
# shape (1, 20, 128)
# [array([[-0.00218201,  0.14758301, ...,  -0.02207947,  0.16833496]], dtype=float32)]

🔄 Rerankers

from fastembed.rerank.cross_encoder import TextCrossEncoder

query = "Who is maintaining Qdrant?"
documents: list[str] = [
    "This is built to be faster and lighter than other embedding libraries e.g. Transformers, Sentence-Transformers, etc.",
    "fastembed is supported by and maintained by Qdrant.",
]
encoder = TextCrossEncoder(model_name="Xenova/ms-marco-MiniLM-L-6-v2")
scores = list(encoder.rerank(query, documents))

# [-11.48061752319336, 5.472434997558594]

Text cross encoders can also be extended with models which are not in the list of supported models.

from fastembed.rerank.cross_encoder import TextCrossEncoder 
from fastembed.common.model_description import ModelSource

TextCrossEncoder.add_custom_model(
    model="Xenova/ms-marco-MiniLM-L-4-v2",
    model_file="onnx/model.onnx",
    sources=ModelSource(hf="Xenova/ms-marco-MiniLM-L-4-v2"),
)
model = TextCrossEncoder(model_name="Xenova/ms-marco-MiniLM-L-4-v2")
scores = list(model.rerank_pairs(
    [("What is AI?", "Artificial intelligence is ..."), ("What is ML?", "Machine learning is ..."),]
))

⚡️ FastEmbed on a GPU

FastEmbed supports running on GPU devices. It requires installation of the fastembed-gpu package.

pip install fastembed-gpu

Check our example for detailed instructions, CUDA 12.x support and troubleshooting of the common issues.

from fastembed import TextEmbedding

embedding_model = TextEmbedding(
    model_name="BAAI/bge-small-en-v1.5", 
    providers=["CUDAExecutionProvider"]
)
print("The model BAAI/bge-small-en-v1.5 is ready to use on a GPU.")

Usage with Qdrant

Installation with Qdrant Client in Python:

pip install qdrant-client[fastembed]

or

pip install qdrant-client[fastembed-gpu]

You might have to use quotes pip install 'qdrant-client[fastembed]' on zsh.

from qdrant_client import QdrantClient, models

# Initialize the client
client = QdrantClient("localhost", port=6333) # For production
# client = QdrantClient(":memory:") # For experimentation

model_name = "sentence-transformers/all-MiniLM-L6-v2"
payload = [
    {"document": "Qdrant has Langchain integrations", "source": "Langchain-docs", },
    {"document": "Qdrant also has Llama Index integrations", "source": "LlamaIndex-docs"},
]
docs = [models.Document(text=data["document"], model=model_name) for data in payload]
ids = [42, 2]

client.create_collection(
    "demo_collection",
    vectors_config=models.VectorParams(
        size=client.get_embedding_size(model_name), distance=models.Distance.COSINE)
)

client.upload_collection(
    collection_name="demo_collection",
    vectors=docs,
    ids=ids,
    payload=payload,
)

search_result = client.query_points(
    collection_name="demo_collection",
    query=models.Document(text="This is a query document", model=model_name)
).points
print(search_result)

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

fastembed_bio-0.1.0.tar.gz (78.7 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

fastembed_bio-0.1.0-py3-none-any.whl (121.1 kB view details)

Uploaded Python 3

File details

Details for the file fastembed_bio-0.1.0.tar.gz.

File metadata

  • Download URL: fastembed_bio-0.1.0.tar.gz
  • Upload date:
  • Size: 78.7 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.13.7

File hashes

Hashes for fastembed_bio-0.1.0.tar.gz
Algorithm Hash digest
SHA256 66725507b987b51bf5a51a6d159ad9e881f9e368e536610c8d8e096646b8eac2
MD5 37d17e6fbc95980e3bf296def9218959
BLAKE2b-256 b71034d1c3b96d3a48d6f63e3e5003350418062a0ef3589a32e100c43b51ccb7

See more details on using hashes here.

Provenance

The following attestation bundles were made for fastembed_bio-0.1.0.tar.gz:

Publisher: python-publish.yml on nleroy917/fastembed-bio

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file fastembed_bio-0.1.0-py3-none-any.whl.

File metadata

  • Download URL: fastembed_bio-0.1.0-py3-none-any.whl
  • Upload date:
  • Size: 121.1 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.13.7

File hashes

Hashes for fastembed_bio-0.1.0-py3-none-any.whl
Algorithm Hash digest
SHA256 fe88598dcdd8c93ab994436b8e8cf3ea9f73e298d7678869f29e4e7c9339a9d3
MD5 a099ccaf07e6b2e7fe9304a4c01c6e2e
BLAKE2b-256 6dc79fbf38948baaf8349517f192b4d19060fe2eedb4d6f02e9a28267e37470a

See more details on using hashes here.

Provenance

The following attestation bundles were made for fastembed_bio-0.1.0-py3-none-any.whl:

Publisher: python-publish.yml on nleroy917/fastembed-bio

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page