Python SDK for IEDB Tools API. Full details can be found at http://tools.iedb.org/main/tools-api/
Project description
IEDB API Tools Python SDK
Python SDK for Immune Epitope Database (IEDB) Analysis Tools API. Includes support for the following prediction tools:
- MHC-I peptide binding:
- Determine sequence's ability to bind to MHC class I molecule
- MHC-II peptide binding:
- Determine sequence's ability to bind to MHC class II molecule
- T-cell epitope prediction:
- Use predictors to determine peptide's potential of being a T-cell epitope
- MHC-Natural Peptide:
- Assess probability that peptide is naturally processed by the MHC
- Antibody epitope prediction:
- Predict B-cell epitopes from protein sequence(s)
View the web application
Installation
Run the following to install:
pip install iedb
Usage
import iedb
# Send POST request to MHC class I peptide binding prediction tool:
mhci_res = iedb.query_mhci_binding(method="recommended", sequence="ARFTGIKTA", allele="HLA-A*02:01", length=8)
# Send POST request to MHC class II peptide binding prediction tool:
mhcii_res = iedb.query_mhcii_binding(method="nn_align", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-DRB1*01:01", length=None)
# Send POST request to T-cell epitope prediction tool:
tcell_res = iedb.query_tcell_epitope(method="smm", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-A*01:01", length=9, proteasome='immuno')
# Send POST request to peptide prediction tool:
pep_res = iedb.query_peptide_prediction(method="mhcnp", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-A*02:01", length=9)
# Send POST request to B-cell epitope prediction tool:
bcell_res = iedb.query_bcell_epitope(method="Emini", sequence="VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTE", window_size=9)
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
iedb-0.0.2.tar.gz
(5.9 kB
view hashes)
Built Distribution
iedb-0.0.2-py3-none-any.whl
(6.6 kB
view hashes)