Skip to main content

IPC (Isoelectric Point Calculator) - prediction of isoelectric point of proteins and peptides

Project description

IPC is a program (available also as web service at isoelectric.org) for the accurate estimation of protein and peptide isoelectric point (pI) using Henderson-Hasselbach equation and pKa sets.

It allows you to compute theoretical pI using 16 pKa sets (for individual references see http://isoelectric.org/theory.html)

IPC introduce also two new computationally optimized pKa sets. They were benchmarked against 14 different pKa sets and 3 pI prediction programs on two protein databases (2,324 proteins) and three peptide datasets (16,882 peptides).

Program is written in Python programing language and thus it should be able to run it on any operating system.

AUTHOR: Lukasz Pawel Kozlowski, lukaszkozlowski.lpk@gmail.com COPYRIGHTS: Lukasz Pawel Kozlowski LICENCE: PUBLIC DOMAIN http://isoelectric.org/license.txt

How to cite:

Kozlowski LP (2016) IPC - Isoelectric Point Calculator. Biology Direct 11:55. doi: http://dx.doi.org/10.1186/s13062-016-0159-9

INSTALLATION:

wget http://isoelectric.org/ipc.zip; unzip ipc.zip; # sudo apt-get install unzip (if not present) cd ipc; sudo python setup.py install

USAGE:

python ipc.py <fasta_file> <output_file> <plot_file>

ipc <fasta_file> <output_file> <plot_file> (if installed into system using setup.py)

<fasta_file>    protein sequence(s) in fasta format, see ./examples
<pKa set>       one from pKa sets which will be used to calculate pI, default 'ALL' (report pI using all models)
                valid options are:
                        'ALL', 'IPC_protein', 'IPC_peptide',
                        'Bjellqvist', 'Dawson', 'Grimsley', 
                        'Toseland', 'EMBOSS', 'Kozlowski', 
                        'DTASelect', 'Wikipedia', 'Rodwell', 
                        'Patrickios', 'Sillero', 'Thurlkill', 
                        'Solomon', 'Nozaki_Tanford', 
                        'Lehninger', 'ProMoST'

<output_file>   output of the program with pI predicted using selected model(s), default name <fasta_file>.pI.txt
<plot_file>     virtual 2D-PAGE scatter plot (molecular weight vs. isoelectric point) represented as heat map, 
                this option is available only if numpy and matplotlib and scipy are installed  

E.g. ipc ./examples/NC_010473_Ecoli.faa ALL out.txt out.png

The result should be following files located in the <fasta_file> directory:

  • NC_010473_Ecoli.faa.pI.txt with predictions
  • NC_010473_Ecoli.faa.png with virtual 2D-PAGE scatter plot

Please note that this exemplary command will predict isoelectric point using all pKa sets for the whole E.coli proteome (4218 proteins). Nevertheless, it should be done in ~5 seconds.

Please, follow the order of input files and parameters. Intentionally, IPC does not use optparse or argparse as those packages are different for different version of python. And their names also may change in future.

Additionally, IPC can be used interactively in python shell:

from isoelectric import ipc
help(ipc)

Help on module ipc:

NAME ipc

FILE /home/lukaskoz/IPC_standalone_version/ipc.py

FUNCTIONS

calculate_molecular_weight(seq)
    molecular weight

check_additional_libraries()
    check libraries for plotting

error_information()
    information how to run IPC script

fasta_reader(fasta_string)
    reads fasta file and return table [ [head1, seq1], [head2, seq2], ...]
    it is endure for all  errors like: multiple line for sequence, white spaces etc.

ipc_author_information()
    add information about IPC

make_heat_map(mw_tab, pI_tab, fasta_file, input_pKa_set)
    virtual 2D-PAGE scatter plot, heat map

predict_isoelectric_point(sequence, input_pKa_set)
    accurate estimation of protein and peptide isoelectric point (pI) 
    using Henderson-Hasselbach equation and pKa sets

predict_isoelectric_point_ProMoST(seq)
    Calculate isoelectric point using ProMoST model

DATA

__author__ = 'Lukasz Pawel Kozlowski'
__copyrights__ = 'Lukasz Pawel Kozlowski'
__email__ = 'lukaszkozlowski.lpk@gmail.com'
__licence__ = 'http://isoelectric.org/licence.txt'
__webserver__ = 'http://isoelectric.org'
aaDict = {'Ala': 'A', 'Arg': 'R', 'Asn': 'N', 'Asp': 'D', 'Asx': 'B', ...
acidic = ['D', 'E', 'C', 'Y']
basic = ['K', 'R', 'H']
promost = {'C': [8.0, 8.28, 9.0], 'D': [3.57, 4.07, 4.57], 'E': [4.15,...
promost_mid = {'A': [7.58, 3.75], 'B': [7.46, 3.57], 'C': [8.12, 3.1],...
sample_protein_sequence = 'MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRG...
scales = {'Bjellqvist': {'C': 9.0, 'Cterm': 3.55, 'D': 4.05, 'E': 4.45...

AUTHOR Lukasz Pawel Kozlowski

In [1]: import ipc
In [2]: ipc.scales.keys()
Out[2]: 
['DTASelect',
 'IPC_protein',
 'Lehninger',
 'Bjellqvist',
 'Toseland',
 'Wikipedia',
 'Grimsley',
 'Patrickios',
 'Rodwell',
 'Solomon',
 'IPC_peptide',
 'Sillero',
 'Dawson',
 'EMBOSS',
 'Nozaki',
 'Thurlkill']

In [3]: sequence = ipc.sample_protein_sequence

In [4]: sequence
Out[4]: 'MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHLHGPPPPPRHHKKAPHDHHGGHGPGKHHR'

In [5]: ipc.predict_isoelectric_point_ProMoST(sequence)
Out[5]: 10.159912109374998

In [6]: ipc.predict_isoelectric_point(sequence)
Out[6]: 9.779560546874999

In [7]: ipc.predict_isoelectric_point(sequence, 'IPC_protein')
Out[7]: 9.779560546874999

In [8]: ipc.predict_isoelectric_point(sequence, 'IPC_peptide')
Out[8]: 10.569521484375

In [9]: ipc.predict_isoelectric_point(sequence, 'EMBOSS')
Out[9]: 10.774326171875

...

Project details


Release history Release notifications | RSS feed

This version

1.0

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

isoelectric-1.0.tar.gz (1.3 MB view details)

Uploaded Source

Built Distribution

isoelectric-1.0-py3-none-any.whl (9.4 kB view details)

Uploaded Python 3

File details

Details for the file isoelectric-1.0.tar.gz.

File metadata

  • Download URL: isoelectric-1.0.tar.gz
  • Upload date:
  • Size: 1.3 MB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/1.14.0 pkginfo/1.5.0.1 requests/2.18.4 setuptools/39.1.0 requests-toolbelt/0.9.1 tqdm/4.28.1 CPython/3.6.8

File hashes

Hashes for isoelectric-1.0.tar.gz
Algorithm Hash digest
SHA256 76fe7ee81f4645222c4658a2cd855d66930c513eb976476485c436dec1228b33
MD5 8ec03da715de9c280e6177772faa20ba
BLAKE2b-256 41e900820750a6de8f7e95efd607ce9e8d2351ef5f2424edc74d6823fdce8079

See more details on using hashes here.

File details

Details for the file isoelectric-1.0-py3-none-any.whl.

File metadata

  • Download URL: isoelectric-1.0-py3-none-any.whl
  • Upload date:
  • Size: 9.4 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/1.14.0 pkginfo/1.5.0.1 requests/2.18.4 setuptools/39.1.0 requests-toolbelt/0.9.1 tqdm/4.28.1 CPython/3.6.8

File hashes

Hashes for isoelectric-1.0-py3-none-any.whl
Algorithm Hash digest
SHA256 711ff8cda595923305937866abfe6c7d36b09505be7da89148ccd6c1df35112a
MD5 5d5ef99b68f8c0818c707f125083c2de
BLAKE2b-256 5bef354d998ab32b57f74480154aa01f1809b94e60b5ae5b0f723b6be47be09d

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page