A custom LPR model for lipid-binding Protein prediction
Project description
license: mit language:
- en base_model:
- EvolutionaryScale/esmc-300m-2024-12
- google-bert/bert-base-uncased new_version: Noora68/lpr-0.4B tags:
- biology
- protein
- protein classification
- lipid binding
- lipid binding site
- recognition
Lipid-Protein Recognition (LPR)
we present a robust prediction tool termed Lipid-Protein Recognition (LPR) for predicting the lipid categories that interact with proteins, utilizing protein sequences as the only input. Using a combined model architecture by the fusion of ESM C and BERT models, our method enables accurate and interpretable prediction to distinguish lipid-binding signature among the 8 major lipid categories defined by LIPID MAPS. LPR will serve as a powerful tool to facilitate the exploration of lipid-binding specificity and rational protein design.
- Paper: https://...
- GitHub Repository: https://github.com/Noora68/Lipid-binding-Protein-Recognition-LPR
- Online Demo: https://colab/
Model Details
- Architecture: ESM Cambrian + BERT + classification head
- Task: Multi-label protein-lipid binding prediction
- Fine-tuned from:
ESMC_300m+bert-base-uncased - Developed by: Noora68
- Framework: PyTorch + HuggingFace Transformers
Model usage workflow:
- Load the model and tokenizer
- Process the input sequence (tokenize → batch → pad → mask)
- Run inference to obtain logits → probabilities
- Output the results and mark high-confidence categories
Usage
from modeling_lpr import LPR
import torch
from torch.nn.utils.rnn import pad_sequence
from esm.tokenization import EsmSequenceTokenizer
# Set device (GPU if available, otherwise CPU)
device = torch.device("cuda" if torch.cuda.is_available() else "cpu")
tokenizer = EsmSequenceTokenizer()
# Default lipid type dictionary
default_dict = {
"0": "NotLipidType",
"1": "Fatty Acyl (FA)",
"2": "Prenol Lipid (PR)",
"3": "Glycerophospholipid (GP)",
"4": "Sterol Lipid (ST)",
"5": "Polyketide (PK)",
"6": "Glycerolipid (GL)",
"7": "Sphingolipid (SP)",
"8": "Saccharolipid (SL)"
}
# Load pretrained LPR model
model = LPR.from_pretrained("Noora68/lpr-0.4B").to(device)
# Example protein sequence
sequence = "MDSNFLKYLSTAPVLFTVWLSFTASFIIEANRFFPDMLYFPM"
# Tokenize the sequence -> input_ids
input_ids = torch.tensor(tokenizer.encode(sequence))
# Add batch dimension: (batch_size=1, length)
input_ids = input_ids.unsqueeze(0)
# Pad to the longest sequence in the batch
input_ids_padded = pad_sequence(input_ids, batch_first=True, padding_value=tokenizer.pad_token_id)
# Build attention mask: 1 for real tokens, 0 for padding
attention_mask = (input_ids_padded != tokenizer.pad_token_id).long()
# Move tensors to the same device as model
input_ids_padded = input_ids_padded.to(device)
attention_mask = attention_mask.to(device)
# Forward pass (no gradient needed during inference)
with torch.no_grad():
outputs = model(input_ids_padded, attention_mask)
# Convert logits to probabilities using sigmoid
probs = torch.sigmoid(outputs['logits'])
# Convert to CPU and numpy array
probs = probs.squeeze().detach().cpu().numpy()
# Print results: add a check mark if probability > 0.6
for i, p in enumerate(probs):
mark = " √" if p > 0.6 else ""
print(f"{default_dict[str(i)]:<25}: {p:.4f}{mark}")
output of the above example is:
NotLipidType : 0.0007
Fatty Acyl (FA) : 0.1092
Prenol Lipid (PR) : 0.9178 √
Glycerophospholipid (GP) : 0.6059 √
Sterol Lipid (ST) : 0.0083
Polyketide (PK) : 0.0026
Glycerolipid (GL) : 0.0771
Sphingolipid (SP) : 0.0002
Saccharolipid (SL) : 0.0000
Limitations
- Trained only on lipid-binding protein data and may not generalize to other functions.
- Model performance is best with sequence lengths under 500.
- Dataset size is limited compared to large-scale protein corpora.
- Model may reflect biases present in training data (e.g., under-representation of certain lipid types).
Citation
If you use this model, please cite:
@article{your2025paper,
title={Deciphering the code of lipid binding by large language model},
author={Feitong Dong,},
journal={Bioinformatics},
year={2025}
}
License
MIT License
Project details
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file lpr_model-0.1.0.tar.gz.
File metadata
- Download URL: lpr_model-0.1.0.tar.gz
- Upload date:
- Size: 5.0 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/6.1.0 CPython/3.12.10
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
bb3bc3da82deef718ee03993dfd0dc82543856f0a3e19fae8f112c7f712f067a
|
|
| MD5 |
c6bfd2a5a6063ab67c75cefcab1f1349
|
|
| BLAKE2b-256 |
daeca22f33ee4eeb48b7217bd3a43b24b78af23a2fa3ed7be836a2c3efc037be
|
File details
Details for the file lpr_model-0.1.0-py3-none-any.whl.
File metadata
- Download URL: lpr_model-0.1.0-py3-none-any.whl
- Upload date:
- Size: 4.9 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/6.1.0 CPython/3.12.10
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
157c0d68fd886953c62e562493a7884e93985243498491d9f5a14f1e8d7ddc50
|
|
| MD5 |
a3e5f5ddaef830230c3b029e9ecad7ee
|
|
| BLAKE2b-256 |
f8470d3bf8e379e2580418e689219bf4700abc2da46ad3e99dcfba4169c3164c
|