Fast and easy to use Python module to parse mmCIF files
Project description
Introduction
Mmcifbuddy
is a lightweigth, easy to use and very fast Python module
for reading of files in the PDBx/mmCIF format[^1] . The mmCIF format is
standard in macromolecular crystallography and structural biology for
storing coordinates and structure factor data.
An mmCIF file consists of categories of information in the form of tables and keyword-value pairs.
The relationships between common data items (e.g. atom and residue identifiers) are explicitly documented within the PDBx Exchange Dictionary which itself is an mmCIF file and can be used to check the validity of any PDB entry[^2]. You can also find tutorials on the mmCIF format here and here,
How to install
The mmcifbuddy
package can be installed from PyPi like this:
$ pip install mmcifbuddy
Details about compiling and installing the package from source code is described in the section *Building the package below.
Usage
The Parser class
The Parser()
class is the main workhorse of mmcifbuddy
and possibly
the only object you will need to instatiate and use. The job of the
Parser class is to handle the parsing of a file in mmCIF format, and it
has the following public facing methods:
open(fp)
: Method to pass an open Python file object to the parser, that has been opened with the Python open() statement, likely within a 'with' context. Otherwise the file must be closed by the caller and not by this class.fopen(fname)
: Method passing the name of the file to be processed. The file will be opened for reading in the module, and may be both plain and gzipped format.fclose()
: Method to close a file opened byfopen()
. This also resets theParser()
class for reuse, if you need to process another file.get_datablock_names()
: This method returns a list of datablock names encountered during the parsing of the file.reset()
: Reset the Parser class for reuse.parse(verbose=True)
: This is the main parsing routine of the class, doing the actual work. It returns a Python dictionary of datablocks which again consists of dictionaries of categories. For a flat parser, useparser_flat
instead.get_dict()
: Returns the dictionary of the last read datablock in the file (in practice there is only one).
The first line in an mmCIF file is a datablock name, consisting of the
string data_
followed by the PDB ident code, for example data_1TTT
.
The mmCIF definition specifies that there can be several datablocks in a
single file. So the first level of the dictionary returned by the parser
is indexed by datablock name. I have not been able to find documentation
for how datablock names are used, however in 207,540 PDB coordinate
entries checked on 2023-08-12 zero files had more than one
datablock. But if you have software that packages more than one
datablock in a .cif file, mmcifbuddy
can deal with it.
In any case, following a call to the parse()
method:
from mmcifbuddy import Parser
myparser = Parser()
myparser.fopen("data/1ttt.cif.gz")
basedict = myparser.parse()
data = myparser.get_dict()
myparser.fclose()
will return a regular Python dictionary contained in the element
basedict['data_1TTT']
, so normally basedict
will only have one
element, which is also returned by the get_dict()
method.
print(basedict.keys())
dict_keys(['data_1TTT'])
print(len(data.keys()))
70
As you can see, the data
dictionary contains 70 entries, which is the
entire content of the data_1TTT
entry.
So to repeat, the dictionary returned by both parsers will always only
have one entry, because as mentioned above, mmCIF files only have one
data_*
entry [^3], and as a convenience, the method get_dict()
returns the last parsed dictionary, or data['data_1TTT']
in the above
example, since this is in practice all you need.
Structure of the data
Mmcifbuddy
provides two parsers that have the same interface. The
ParserFlat()
class returns data in a "flat" dictionary. Consider the
following data in the mmCIF file:
_atom_site.type_symbol
_atom_site.label_atom_id
_atom_site.label_alt_id
The ParserFlat()
class would return it like this:
data['_atom_site.type_symbol']
data['_atom_site.label_atom_id']
data['_atom_site.label_alt_id']
but the Parser()
would return the data nested in mmCIF categories:
data['_atom_site']
and the items could be indexed:
data['_atom_site']['type_symbol']
data['_atom_site']['label_atom_id']
data['_atom_site']['label_alt_id']
Depending on what you want to do, this makes it somewhat easier to pull
out the data you want from the mmCIF file, so if you are only interested
in the atomic coordinates of an mmCIF file, you could just pull out the
data['_atom_site']
dictionary, and process that data further, for
example in a Pandas dataframe, as we shall see later. On the other hand,
if you simply want to pull out single data items from the mmCIF file, it
is easier to user ParserFlat()
and index with the data names directly.
Low level usage
Getting data from the low level lexer
The mmciflexer
module gives low level access to the lexer, the
C-extention module that divides the mmCIF file into a stream of tokens.
This is the module used by the Parser()
classes to fetch the raw
tokens from the mmCIF input file. You will never need to use this module
unless you want to do low level handling of the mmCIF file from your
program.
The mmciflexer
module exposes the following methods:
fopen(fname)
callslexer_open_with_filename()
: This method opens the named file mmCIF file for reading. The file can be straight text og gzip compressed.open()
callslexer_open_with_fd()
: Pass an open Python file descriptor for reading to the module. To be used when Python takes responsibiliy for opening and closing the file. NOTE: Opening the file this way can not handle gzipped files, but can be used if you prefer a more "pythonic" programming style.set_debug_mode()
callslexer_set_debug_mode()
Set debug mode on (1) or off (0)fclose()
callslexer_close_file()
: Close mmCIF fileget_token()
callslexer_get_token()
: Get the next token from mmCIF file
Using the lexer
Here is an example of how you can use the low level lexer. In this
example we are using the open()
method that is context aware and thus
can be used within a Python with open()
construct. When opening the
mmCIF file this way, if must be a straight text file.
from mmcifbuddy import mmciflexer as lex
with open("data/4af1.cif") as f:
status = lex.open(f)
typ, token = lex.get_token()
while typ != lex.tEND_OF_FILE:
print(typ, token)
typ, token = lex.get_token()
Just so you can see the difference between using open()
and fopen()
,
here is another snippet of code accomplishing a similar thing. Here we
can read a gzipped file, but the code is less "pythonic".
status = lex.fopen("data/1psr.cif.gz")
typ, token = lex.get_token()
while typ != lex.tEND_OF_FILE:
print(typ, token)
typ, token = lex.get_token()
lex.fclose()
The FileReader module
The FileReader
class described above is actually a simple class
wrapping the lexer.
from mmcifbuddy.filereader import FileReader
with FileReader('4af1.cif') as fr:
for s in fr:
print(s)
This will program will read the input mmCIF file and output (type, token) tuples, the first few lines look like this:
4, 'data_4AF1')
(12, '#')
(1, '_entry.id')
(8, '4AF1')
(12, '#')
(1, '_audit_conform.dict_name')
(8, 'mmcif_pdbx.dic')
(1, '_audit_conform.dict_version')
(8, 5.308)
...
Here, 4 is the mmCIF ID, 12 means "comment", 1 means "a name" and 8 means "data". There are 18 token types recognized by the parser.
Logger
The mmcifbuddy
module contains a logger which simply is a
customization of the built-in Python logging
module. Typically, you
would use the info()
, warning()
and error()
methods:
from mmcifbuddy.logger import logger
logger.info("This is some info text")
logger.warning("Hey did you expect this?")
logger.error("An error happended!")
You can use this logger in your program.
Timer
The mmcifbuddy
module also contains a timer, that can be used to time
operations.
start()
: Start a new timerlap()
: Take a lap timestop()
: Stop the timer, and report the elapsed time
from mmcifbuddy.timer import Timer
clock = Timer() # Instantiate the Timer
myparser = Parser() # Instantiate the parser
myparser.fopen("data/1ttt.cif.gz")
clock.start() # Start the timer
basedict = myparser.parse()
clock.stop() # Stop the timer and print elapsed time
data = myparser.get_dict()
myparser.fclose()
print(f"Read {len(data['_atom_site]['id'])} atoms")
2025-02-11 18:04 [INFO] Done parsing ['data_1TTT']
Elapsed time: 0.3418 seconds
Read 14573 atoms
Running on my 10 year old laptop the parser is fast, corresponding to ~ 0.023 seconds per 1000 atoms.
Examples
Example 1 - Reading an mmCIF file
The first line of an mmCIF file always begins with data_*
which
signals the beginning of a datablock. According to the mmCIF
specification, there can be multiple datablocks in a single file, each
with a unique name.
data_4XB6
#
_entry.id 4XB6
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.279
...
In the first example, let's read an mmCIF file into IPython:
from mmcifbuddy import Parser
myparser = Parser()
myparser.fopen('data/4af1.cif')
_ = myparser.parse()
2025-02-09 23:03 [INFO] Done parsing ['data_4AF1']
parser.fclose()
print(myparser.get_datablock_names())
['data_4AF1']
print(data['data_4AF1']['_entry']['id'])
4AF1
Now the mmCIF file is in memory as an ordinary dictionary, that you can
do with what you want. As mentioned above, the dictionary returned my
the myparser.parse()
call returns a dictionary containing all
datablocks, but we prefer to fetch the structure information using the
get_dict()
method, so we put the result into the Python junk
underscore variable " _
". Then various syntax checkers won't complain
about unused variables.
So we retrieve all the data like this:
data = myparser.get_dict()
and you can list the keys from data1
:
print(data.keys())
dict_keys(['_entry', '_audit_conform', '_database_2', '_pdbx_database_status',
'_audit_author', '_citation', '_citation_author', '_cell', '_symmetry',
'_entity', '_entity_poly', '_entity_poly_seq', '_entity_src_nat',
...
...
'_pdbx_validate_chiral', '_ndb_struct_conf_na', '_ndb_struct_na_base_pair',
'_ndb_struct_na_base_pair_step', '_pdbx_entity_nonpoly'])
(list truncated)
For example, to see what coordinates are stored in the file:
print(data['_atom_site'].keys())
dict_keys(['group_PDB', 'id', 'type_symbol', 'label_atom_id',
'label_alt_id', 'label_comp_id', 'label_asym_id', 'label_entity_id',
'label_seq_id', 'pdbx_PDB_ins_code', 'Cartn_x', 'Cartn_y', 'Cartn_z',
'occupancy', 'B_iso_or_equiv', 'pdbx_formal_charge', 'auth_seq_id',
'auth_comp_id', 'auth_asym_id', 'auth_atom_id', 'pdbx_PDB_model_num'])
This is in reality the same ATOM data you can find in a legacy PDB format file. For fun & illustration, lets store the coordinate data in a pickle file:
import pickle
pdb_id = data['_entry']['id'].lower()
fname = Path(pdb_id).with_suffix('.pck')
with open(fname, 'wb') as outf:
pickle.dump(A, outf)
print(f"Dumped {fname}")
Dumped 1ttt.pck
This saves all the coordinate data in a binary Python pickle file, and because the datastructure is vanilla Python objects, it should be portable and readably in all future versions. You can load this file again in e.g. another program like this:
with open("1ttt.pck", 'rb') as inf:
X = pickle.load(inf)
Example 2 - Print basic crystallographic data
In the following examples, the structure 4af1 is used. If you follow
along, it's a good idea to copy paste into a Jupyter notebook or to an
IPython session. First we load the data from the mmCIF file as many
times before in the above. We get all the information from the file into
the data
dictionary.
path = Path("data/4af1.cif")
myparser = Parser()
myparser.fopen(path)
_ = myparser.parse()
data = myparser.get_dict()
Now, lets print some information from the file, and store the title in a variable:
print(data['_entry']['id'])
entry_title = data['_entity_name_com']['name'].title()
print(entry_name)
4AF1
Translation Termination Factor Arf1, Release Factor 1
Next, print some basic crystallographic information about this structure:
print("Unit Cell")
print(f"\ta: {data['_cell']['length_a']}")
print(f"\tb: {data['_cell']['length_b']}")
print(f"\tc: {data['_cell']['length_b']}")
print(f"\talpha: {data['_cell']['angle_alpha']}")
print(f"\tbeta: {data['_cell']['angle_beta']}")
print(f"\tgamma: {data['_cell']['angle_gamma']}")
print(f"\tZ: {data['_cell']['Z_PDB']}")
print("Space Group")
print(f"\tName: {data['_symmetry']['space_group_name_H-M']}")
print(f"\tNumber: {data['_symmetry']['Int_Tables_number']}")
giving the following output:
Unit Cell
a: 131.02
b: 31.99
c: 31.99
alpha: 90.0
beta: 113.47
gamma: 90.0
Z: 4
Space Group
Name: C 1 2 1
Number: 5
Example 3 - Extracting the sequence into a file
Next we will extract the sequence information from the mmCIF file, and this time we use the flat parser. For fun we also time the operation:
from mmcifbuddy import ParserFlat
from mmcifbuddy.timer import Timer
stopwatch = Timer()
stopwatch.start()
myparser_f = ParserFlat()
myparser_f.fopen(path)
_ = myparser_f.parse()
data_f = myparser_f.get_dict()
stopwatch.stop()
Notice that we store the output from the flat parser in the variable
data_f
as to not overwrite the nested data. Running the above lines
gives this output:
2025-02-11 19:10 [INFO] Done parsing ['data_4AF1']
Elapsed time: 0.1771 seconds
Now let us look at the sequence data, in the mmCIF file it is stored in
the _entity_poly
category and the pdbx_seq_one_letter_code
item.
pdb_id = data_f['_entry.id']
print(pdb_id)
seq_list = data_f['_entity_poly.pdbx_seq_one_letter_code']
print(seq_list)
This gives the output:
4AF1
['MSEQDEVPSEDRRKYEFRKVIEELKDYEGSGTQLVTIYIPPDKQISDVVAHVTQEHSEASNIKSKQTRTNVQDALTSIKD', 'RLRYYDTFPPDNGMVVFSGAVDSGGGRTDMVTEVLESPPQPIESFRYHCDSAFLTEPLAEMLGDKGLYGLIVLDRRESNV', 'GWLKGKRVQPVKSAESLVPGKQRKGGQSAQRFARLRLEAIDNFYQEVAGMADDLFVPKRHEIDGILVGGPSPTKDEFLDG', 'DYLHHELQDKVLGKFDVSYTDESGLSDLVDAGQAALAEADLMDDKSDMEEFFEELNGGKLATYGFEQTRRNLIMGSVDRL', 'LVSEDLREDVVIYECPNDHEEYETIDRRNTSPEHTCSDCGEEATEVDREDAIDHLMSIADQRGTETHFISTDFEKGEQLL',
'TAFGGYAGILRYSTGV']
As you can see, the sequence data is stored in a list of lines of length
80 characters. We can concatenate the data into a single string using
the Python string join()
method:
# Join the list into a string
seq = ''.join(data_f['_entity_poly.pdbx_seq_one_letter_code'])
seq_len = len(seq)
print(len(seq))
416
Notice that we stored the length of the sequence in the seq_len
variable. Now lets store the sequence database ID in a variable, as well
as the name of the organism:
seq_id = data_f['_struct_ref_seq.pdbx_db_accession']
organism = data_f['_entity_src_gen.pdbx_gene_src_scientific_name']
And now we can print the sequence in FASTA format:
print(f">{seq_id} {seq_len} {entry_name} ({organism.title()})")
for line in seq_list:
print(line)
giving the output:
>Q9HNF0 416 Translation Termination Factor Arf1, Release Factor 1 (Halobacterium Salinarum)
MSEQDEVPSEDRRKYEFRKVIEELKDYEGSGTQLVTIYIPPDKQISDVVAHVTQEHSEASNIKSKQTRTNVQDALTSIKD
RLRYYDTFPPDNGMVVFSGAVDSGGGRTDMVTEVLESPPQPIESFRYHCDSAFLTEPLAEMLGDKGLYGLIVLDRRESNV
GWLKGKRVQPVKSAESLVPGKQRKGGQSAQRFARLRLEAIDNFYQEVAGMADDLFVPKRHEIDGILVGGPSPTKDEFLDG
DYLHHELQDKVLGKFDVSYTDESGLSDLVDAGQAALAEADLMDDKSDMEEFFEELNGGKLATYGFEQTRRNLIMGSVDRL
LVSEDLREDVVIYECPNDHEEYETIDRRNTSPEHTCSDCGEEATEVDREDAIDHLMSIADQRGTETHFISTDFEKGEQLL
TAFGGYAGILRYSTGV
You can of course write this to a file instead of the screen.
Example 4 - Extract secondary structure
In this example, we will extract the secondary structure information
stored in the mmCIF file. The description of the secondary structure in
an mmCIF file is found in two categories: _struct_conf
and
_struct_sheet_range
. You can tell that the mmCIF format has been
written by committee. struct_conf
stores secondary structure
information of helices and struct_sheet_range
stores secondary
structure information for beta strands.
To make it simple, we use Pandas:
import pandas as pd
If you don't have Pandas installed, use pip install pandas
to do so.
Helices
First, lets try to extract information about helices:
helices = pd.DataFrame.from_dict(data['_struct_conf'])
helices.head()
If you're running this in Jupyter or IPython, the helices.head()
statement will give a nicely formatted table. If you're running it in a
script, you must wrap it in a print
statement. The helices
dataframe
contains 20 columns, but we will only need some of them. However, we
will add a few columns of our own. From the mmCIF table, we will only
use a few data items:
-
beg_auth_asym_id
: chain ID, e.g. 'A' -
beg_auth_seq_id
: sequence number, e.g. 175These are the author defined residue names, which you normally want if you are going to be looking at the paper, where the authors likely will use this nomenclature. PDB also provides their residue numbers, however in this structure they are the same.
helices['type'] = "alpha"
helices['begin'] = helices['beg_auth_asym_id'] + helices['beg_auth_seq_id'].astype(str)
helices['end'] = helices['end_auth_asym_id'] + helices['end_auth_seq_id'].astype(str)
What happened here looks strange, but it's really quite simple. First, we add a column with the word "alpha" in every cell. Next, we combine the sequence ID (for example "A") with the beginning and end sequence numbers (for example "123") to generate residue number of the type "A123". So now, from the data already in the dataframe, we have generated columns describing the type, and beginning and end residue names of each helix in the table. Let's print out this info:
for index, row in helices.iterrows():
print(row['type'], row['id'], row['begin'], row['end'])
giving:
alpha HELX_P1 A9 A26
alpha HELX_P2 A44 A59
alpha HELX_P3 A60 A62
alpha HELX_P4 A64 A82
alpha HELX_P5 A83 A85
alpha HELX_P6 A192 A216
alpha HELX_P7 A230 A240
alpha HELX_P8 A244 A249
alpha HELX_P9 A263 A272
alpha HELX_P10 A272 A281
alpha HELX_P11 A281 A297
alpha HELX_P12 A304 A314
alpha HELX_P13 A371 A382
alpha HELX_P14 A393 A402
Beta strands
Next, lets extract beta strands. We do it in the same way as with helices, with slight changes because the beta strand information in the mmCIF file is a bit different (written by committee). Fortunately most of the item names are the same:
strands = pd.DataFrame.from_dict(data['_struct_sheet_range'])
strands.head()
Again, we generate a few new columns in the dataframe. We add a column
of "beta", and this time, it's necessary to generate an ID column,
because the strands are named with non-unique integers. So we overwrite
the column strands['id']
by concatenating the sheet_id
with the id
giving a new column of strings, that overwrites the old id
column.
Then, we again generate begin/end residue names. Again, we only use a
few columns from the mmCIF table.
strands['type'] = "beta"
strands['id'] = strands['sheet_id'] + strands['id'].astype(str)
strands['begin'] = strands['beg_auth_asym_id'] + strands['beg_auth_seq_id'].astype(str)
strands['end'] = strands['end_auth_asym_id'] + strands['end_auth_seq_id'].astype(str)
Let's print out this data:
for index, row in strands.iterrows():
print(row['type'], row['id'], row['begin'], row['end'])
giving the output:
beta AA1 A108 A116
beta AA2 A94 A102
beta AA3 A34 A39
beta AA4 A126 A130
beta AB1 A167 A175
beta AB2 A157 A164
beta AB3 A147 A153
beta AB4 A222 A229
beta AB5 A251 A256
beta AC1 A301 A303
beta AC2 A406 A410
beta AC3 A317 A323
beta AC4 A385 A389
beta AD1 A342 A346
beta AD2 A328 A334
beta AD3 A364 A370
Joining the tables
Now, we have to dataframes, helices
containing information about alpha
helices, and strands
containing information about beta strands. Let's
join them into a single dataframe df
:
df = pd.concat([helices, strands], ignore_index=True)
We choose ignore_index
because the two tables' indeces both start
at 1. Now, we can print the data again like before:
for index, row in df.sort_values('begin').iterrows():
print(row['type'],"\t", row['id'], row['begin'], row['end'])
this gives a list of alpha and beta segments, sorted in order of their first residue:
beta AA1 A108 A116
beta AA4 A126 A130
beta AB3 A147 A153
beta AB2 A157 A164
beta AB1 A167 A175
alpha HELX_P6 A192 A216
beta AB4 A222 A229
alpha HELX_P7 A230 A240
alpha HELX_P8 A244 A249
beta AB5 A251 A256
alpha HELX_P9 A263 A272
alpha HELX_P10 A272 A281
alpha HELX_P11 A281 A297
beta AC1 A301 A303
alpha HELX_P12 A304 A314
beta AC3 A317 A323
beta AD2 A328 A334
beta AA3 A34 A39
beta AD1 A342 A346
beta AD3 A364 A370
alpha HELX_P13 A371 A382
beta AC4 A385 A389
alpha HELX_P14 A393 A402
beta AC2 A406 A410
alpha HELX_P2 A44 A59
alpha HELX_P3 A60 A62
alpha HELX_P4 A64 A82
alpha HELX_P5 A83 A85
alpha HELX_P1 A9 A26
beta AA2 A94 A102
Again, if you're using Jupyter for these examples, we can do better, because Jupyter has a really nice display of dataframes. Let's copy the data we want into a new dataframe:
df = df[['type', 'id', 'begin', 'end']].copy()
print(len(df))
30
So, there are 30 secondary structural elements, so let's display all 30
in Jupyter (by default head()
only displays 10):
df.head(30)
Example 5 - Write a PDB file
The atomic coordinate data is stored in the mmCIF file in the
atom_site
category, so in this example we will use the nested parser.
We still have the data stored in the data
variable. We are going to
produce a file with ATOM
records
in the legacy PDB format, detailed in the following table:
COLUMNS DATA TYPE FIELD DEFINITION
-------------------------------------------------------------------------------------
1 - 6 Record name "ATOM "
7 - 11 Integer serial Atom serial number.
13 - 16 Atom name Atom name.
17 Character altLoc Alternate location indicator.
18 - 20 Residue name resName Residue name.
22 Character chainID Chain identifier.
23 - 26 Integer resSeq Residue sequence number.
27 AChar iCode Code for insertion of residues.
31 - 38 Real(8.3) x Orthogonal coordinates for X in Angstroms.
39 - 46 Real(8.3) y Orthogonal coordinates for Y in Angstroms.
47 - 54 Real(8.3) z Orthogonal coordinates for Z in Angstroms.
55 - 60 Real(6.2) occupancy Occupancy.
61 - 66 Real(6.2) tempFactor Temperature factor.
77 - 78 LString(2) element Element symbol, right-justified.
79 - 80 LString(2) charge Charge on the atom.
First, we define a Python format string corresponding to the ATOM record:
pdb_id = data['_entry.id'].lower()
format_str = "{:<6s}{:5d} {:<4s}{:1s}{:3s} {:1s}{:4d}{:1s} {:8.3f}{:8.3f}{:8.3f}{:6.2f}{:6.2f} {:>2s}{:2s}"
# Line measure
print("....+....|....+....|....+....|....+....|....+....|....+....|....+....|....+....")
For convienience, store the data we need in a dictionary called A
:
A = data['_atom_site']
Let's just print out the first 10 atoms in PDB format:
for i in range(10):
formatted_value = format_str.format(
A['group_PDB'][i],
A['id'][i],
A['label_atom_id'][i],
A['label_alt_id'][i],
A['label_comp_id'][i],
A['label_asym_id'][i],
A['label_seq_id'][i],
A['pdbx_PDB_ins_code'][i],
A['Cartn_x'][i],
A['Cartn_y'][i],
A['Cartn_z'][i],
A['occupancy'][i],
A['B_iso_or_equiv'][i],
A['type_symbol'][i],
A['pdbx_formal_charge'][i]
)
print(formatted_value)
This generates the following list. The "ruler" is simply so I could check if the format was correct, it's not part of the data, but you are invited to check for yourself.
....+....|....+....|....+....|....+....|....+....|....+....|....+....|....+....
ATOM 1 N .VAL A 7? 29.794 -20.534 35.440 1.00105.45 N?
ATOM 2 CA .VAL A 7? 29.668 -19.426 34.501 1.00104.35 C?
ATOM 3 C .VAL A 7? 29.115 -19.894 33.156 1.00102.06 C?
ATOM 4 O .VAL A 7? 29.831 -20.514 32.367 1.00102.63 O?
ATOM 5 CB .VAL A 7? 31.023 -18.729 34.283 1.00105.81 C?
ATOM 6 CG1 .VAL A 7? 30.867 -17.548 33.340 1.00105.83 C?
ATOM 7 CG2 .VAL A 7? 31.603 -18.281 35.614 1.00106.42 C?
ATOM 8 N .PRO A 8? 27.833 -19.593 32.892 1.00 98.49 N?
ATOM 9 CA .PRO A 8? 27.127 -20.014 31.674 1.00 95.06 C?
ATOM 10 C .PRO A 8? 27.610 -19.305 30.406 1.00 91.15 C?
There's still some problems in the output however. FIrst the altLoc
column should by blank if there is not alternate location for that atom.
Second, the iCode
column for inserted residues should be blank except
for inserted residues. Third, the charge
column (last column) should
be blank except for atoms that have a charge, in which case it's a small
integer, positive or negative. And finally, there's a problem with the
atom name (name
) column. It has 4 characters available, the first two
is the element, and the last to is the branch. So the C-alpha from an
amino acid is designated '.CA.' and a calcium atom would be named 'CA..'
in that column. As an exercise, you are invited to solve these problems,
as well as write the output to a file.
Example 6 - Importing data in Polars
If you have Polars installed, typing the following into iPython:
import polars as pl
df2 = pl.from_dict(data['_atom_site'])
df2.head()
shape: (5, 21)
will yield the following output:
┌───────────┬─────┬─────────────┬───────────────┬───┬──────────────┬──────────────┬──────────────┬────────────────────┐
│ group_PDB ┆ id ┆ type_symbol ┆ label_atom_id ┆ … ┆ auth_comp_id ┆ auth_asym_id ┆ auth_atom_id ┆ pdbx_PDB_model_num │
│ --- ┆ --- ┆ --- ┆ --- ┆ ┆ --- ┆ --- ┆ --- ┆ --- │
│ str ┆ i64 ┆ str ┆ str ┆ ┆ str ┆ str ┆ str ┆ i64 │
╞═══════════╪═════╪═════════════╪═══════════════╪═══╪══════════════╪══════════════╪══════════════╪════════════════════╡
│ ATOM ┆ 1 ┆ N ┆ N ┆ … ┆ VAL ┆ A ┆ N ┆ 1 │
│ ATOM ┆ 2 ┆ C ┆ CA ┆ … ┆ VAL ┆ A ┆ CA ┆ 1 │
│ ATOM ┆ 3 ┆ C ┆ C ┆ … ┆ VAL ┆ A ┆ C ┆ 1 │
│ ATOM ┆ 4 ┆ O ┆ O ┆ … ┆ VAL ┆ A ┆ O ┆ 1 │
│ ATOM ┆ 5 ┆ C ┆ CB ┆ … ┆ VAL ┆ A ┆ CB ┆ 1 │
└───────────┴─────┴─────────────┴───────────────┴───┴──────────────┴──────────────┴──────────────┴────────────────────┘
Example 7 - Structure factors
You can read mmCIF structure factor files in exactly the same way we've been doing above, but of course the categories and items in a structure factor file is different from a coordinate file. Here is a brief example how it works
from mmcifbuddy import Parser
fnam = "data/r4xb6sf.ent.gz"
myparser = Parser()
myparser.fopen(fnam)
_ = myparser.parse()
data = myparser.get_dict()
print(data['_cell'])
print(data[ '_diffrn_radiation_wavelength'])
print(data[ '_symmetry'])
This produces the output:
{'entry_id': '4xb6', 'length_a': 95.51, 'length_b': 133.71, 'length_c': 176.74, 'angle_alpha': 90.0, 'angle_beta': 90.0, 'angle_gamma': 90.0}
{'id': 1, 'wavelength': '.'}
{'entry_id': '4xb6', 'space_group_name_H-M': 'P 21 21 21', 'Int_Tables_number': 19}
Building the package
The source code resides in two directories: src/
, which contains the
lexer, and mmcifbuddy
, which contains the parser. The directory
structure of mmcifbuddy
is shown below.
.
├── mmcifbuddy/
├── mmcifbuddy/mmciflexer/
├── src/
The lexer is written in C and lex. The lex code is found in the file
src/mmcif.lex
, which requires flex
to be converted in the C code in
src/lex.mmcif.c
. This compilation is only required when changes are
made to mmcif.lex
, in which case it will be generated by
src/Makefile
, but requires flex
to be installed on the system. The C
source src/lex.mmcif.c
is included in the distribution so it is not
normally required.
The job of the lexer is to break down the stream of lines from the mmcif file into tokens that can be interpreted by the parser. The lexer is able to read data from mmcif files in text format as well as gzip compressed.
First, you need to make sure the Python modules setuptools
and build
are available on your computer [^4]. You also need to install a C
compiler, the Python development library and Python virtual environment
modules, that are required for building the Python package. For a Debian
familiy system:
sudo apt install python3-setuptools python3-build
sudo apt install build-essential libpython3-dev python3-venv
To build the package, run make
in the parent directory:
cd mmcifbuddy-0.6.0
make
This will first compile the lexer in src
, then install the compiled C
extension module in mmcifbuddy/mmciflexer/
which thus becomes the
lexer module used by the parser. Then, the makefile calls the Python
build module that builds a wheel that will be placed in the directory
dist/
. The Python build module also creates a directory build/
which
you can delete.
You can then install the wheel[^5] on your server using pip
.
cd dist
pip install mmcifbuddy-0.6.0-cp312-cp312-linux_x86_64.whl
Author and maintainer
- Morten Kjeldgaard <mortenkjeldgaard@gmail.com>
- Copyright 2023-2025 Morten Kjeldgaard
- License: EUPL 1.2
[^1]: The mmCIF format is described here in a short and easy to read introduction.
[^2]: However, mmcifbuddy
does not parse mmCIF dictionary files in the
current implementation (and probably never will).
[^3]: However, the parser is able to handle more than one data_
section per file if such a situation should ever arise.
[^4]: On Debian family systems install packages python3-setuptools
and
python3-build
, on Arch family systems these packages are
python-setuptools
and python-build
.
[^5]: A wheel is an ordinary zip archive. You can inspect its content
using unzip -l
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
File details
Details for the file mmcifbuddy-0.6.2.tar.gz
.
File metadata
- Download URL: mmcifbuddy-0.6.2.tar.gz
- Upload date:
- Size: 264.3 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.11.2
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 |
629888802112072c5326ac5d41358dcf8552ad0116fd25815281317b0ddc366d
|
|
MD5 |
e3eb06fc25a19f8201ea841aa8998b63
|
|
BLAKE2b-256 |
f1e17ef224e9573b0304e2a6dc9a1a0414fb9a6b8a12d7f3946edcea55c77b3e
|