PEPE
PEPE (Pipeline for Easy Protein Embedding) is a tool for extracting embeddings and attention matrices from protein sequences using pre-trained models. This tool supports various configurations for extracting embeddings and attention matrices, including options for handling CDR3 sequences. Currently implemented models are ESM2 from the 2023 paper "Evolutionary-scale prediction of atomic-level protein structure with a language model" and AntiBERTa2-CSSP from the 2023 conference paper "Enhancing Antibody Language Models with Structural Information". PEPE also supports custom PLMs from local files or from Huggingface Hub addresses.
Citation
PEPE: Scalable extraction of multi-modal protein language model representations Jahn Zhong, Niccolò Cardente, Geir Kjetil Sandve, Habib Bashour, Maria Francesca Abbate, Victor Greiff bioRxiv (2026) DOI: 10.1101/2025.10.13.680902
Quick start
-
Install PEPE
From PyPI:
pip install pepe-cli
From Conda:
conda install -c jahn_zhong pepe-cli
Or install from the GitHub repository:
git clone https://github.com/csi-greifflab/pepe-cli cd pepe-cli pip install .
-
(Optional) For ESMC models (e.g.
biohub/ESMC-300M), install Biohub's transformers fork:pip install git+https://github.com/Biohub/transformers.git@main
-
Extract embeddings:
Extract mean pooled embeddings from protein amino acid sequences in FASTA file:pepe --experiment_name <optional_string> --fasta_path <file_path> --output_path <directory> --model_name <model_name>
Quick start with Library
PEPE can also be used as a Python library. This allows for programmatic access to protein embeddings without using the command-line interface.
- Install PEPE (see above for details).
- Use the
pepe.embed()function in your script:
import pepe
# Example: Embed sequences from a dictionary
sequences = {
"prot1": "MADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK",
"prot2": "MERIKELRDLMSQSRTREILTKLAEAGIDVPRLFK"
}
results = pepe.embed(
model_name="facebook/esm2_t6_8M_UR50D",
sequences=sequences,
output_path="my_embeddings",
extract_embeddings=["mean_pooled"],
device="cpu" # Use "cuda", "cuda:0", "cuda:1", etc. if available
)
# Or from a FASTA file
pepe.embed(
model_name="facebook/esm2_t6_8M_UR50D",
fasta_path="path/to/fasta",
output_path="my_embeddings",
extract_embeddings=["mean_pooled"],
device="cpu" # Use "cuda" if available
)
Advanced Usage
For more control, you can use the embedder classes directly:
from pepe.model_selecter import select_model
# Select the appropriate model class
# This acts as a factory returning the correct subclass (ESMEmbedder, HuggingfaceEmbedder, etc.)
ModelClass = select_model("esm2_t6_8M_UR50D")
# Initialize the embedder
embedder = ModelClass(
model_name="facebook/esm2_t6_8M_UR50D",
fasta_path="path/to/sequences.fasta",
output_path="output_directory",
extract_embeddings=["mean_pooled", "attention_head"],
layers=[[-1], [6]] # Layers are expected as a list of lists of ints
)
# Run the embedding pipeline
embedder.run()
Memory Management & Large Scale Processing
PEPE is designed to handle protein datasets of any size by utilizing streamed outputs and memory mapping. This feature is enabled by default (streaming_output=True).
- CLI Usage: No action needed. PEPE automatically streams batches to disk to avoid OOM errors.
- Library Usage: When using
pepe.embed()or the embedder classes, the returned object does not hold the full embeddings in RAM. Instead, it providesnumpy.memmaphandles to the data on disk.
import pepe
# Returns an embedder object
results = pepe.embed(
model_name="facebook/esm2_t6_8M_UR50D",
sequences=sequences,
output_path="large_dataset_output"
# streaming_output=True <-- Default
)
# The embeddings are NOT loaded into RAM here.
# 'data' is a numpy.memmap object pointing to the file on disk.
data = results.mean_pooled["output_data"][-1]
# You can slice it like a normal array, which only loads those specific rows into RAM
first_100_embeddings = data[:100]
# Optimizing RAM usage:
# If you are done with the model but want to keep working with the data,
# you can delete the embedder object to free up GPU/CPU memory while keeping the memmaps.
del results
Handling Long Sequences (Splitting & Reconstruction)
Some models have strict architectural limits on input length (e.g., 1024 for ESM-2, 256 for AntiBERTa2). PEPE can automatically detect sequences that exceed these limits and handle them through chunking and reconstruction.
- Automatic Detection: When
--split_long_sequencesis enabled, PEPE automatically identifies sequences exceeding the model's capacity. - Overlapping Chunks: Use
--split_overlapto maintain context between chunks. - Reconstruction:
- In Library mode, sequences are reconstructed in memory automatically after
embed(). - In CLI mode, sequences are reconstructed if
streaming_output=False. Ifstreaming_output=True, chunks are exported individually to maximize efficiency and minimize RAM usage.
- In Library mode, sequences are reconstructed in memory automatically after
# Library Example: Process a 2000 AA protein with ESM-2 (1024 limit)
results = pepe.embed(
model_name="facebook/esm2_t33_650M_UR50D",
sequences={"long_prot": "M" * 2000},
split_long_sequences=True,
split_overlap=50
)
# 'results.per_token' will contain a single reconstructed tensor of length ~2002
# (including special tokens) despite the model's 1024 limit.
Performance Optimization
If you have sufficient RAM to hold the entire dataset in memory, you can disable streaming output for faster execution. This avoids the overhead of writing to disk during the embedding process.
results = pepe.embed(
model_name="facebook/esm2_t6_8M_UR50D",
sequences=sequences,
output_path="output",
streaming_output=False # Store everything in valid RAM for speed
)
# Now 'results.mean_pooled["output_data"]' is a standard Numpy object
# accessible immediately in memory.
List of supported models:
- ESM-family models
- ESM1:
- esm1_t34_670M_UR50S
- esm1_t34_670M_UR50D
- esm1_t34_670M_UR100
- esm1_t12_85M_UR50S
- esm1_t6_43M_UR50S
- esm1b_t33_650M_UR50S
- esm1v_t33_650M_UR90S_1
- esm1v_t33_650M_UR90S_2
- esm1v_t33_650M_UR90S_3
- esm1v_t33_650M_UR90S_4
- esm1v_t33_650M_UR90S_5
- ESM2:
- esm2_t6_8M_UR50D
- esm2_t12_35M_UR50D
- esm2_t30_150M_UR50D
- esm2_t33_650M_UR50D
- esm2_t36_3B_UR50D
- esm2_t48_15B_UR50D
- ESM1:
- Huggingface Transformer models
- T5 transformer models
- Rostlab/prot_t5_xl_half_uniref50-enc
- Rostlab/ProstT5
- RoFormer models
- alchemab/antiberta2-cssp
- alchemab/antiberta2
- ESMC models (requires Biohub transformers fork; see install instructions above)
- biohub/ESMC-300M
- biohub/ESMC-600M
- biohub/ESMC-6B
- Custom Hugging Face models
- Any compatible model from Hugging Face Hub:
username/model-name - Private models with authentication
- Local Hugging Face models
- Any compatible model from Hugging Face Hub:
- T5 transformer models
- Custom Models
- Load your own PyTorch models with custom tokenizers
- Create example with:
python examples/custom_model/create_example_custom_model.py
Arguments
Required Arguments
--model_name(str): Name of model or link to model. Choose from List of supported models or use custom models:- ESM models:
esm2_t33_650M_UR50D - ESMC models:
biohub/ESMC-300M(requires Biohub transformers fork; see Quick start) - Hugging Face models:
username/model-name - Custom PyTorch models:
/path/to/model.ptor/path/to/model_directory/ - Local HF models:
/path/to/local_hf_directory/
- ESM models:
--fasta_path(str): Path to the input FASTA file. If no experiment name is provided, the output files will be named after the input file.--output_path(str): Directory for output files. Will generate a subdirectory for outputs of each output type.
Model Configuration
--tokenizer_from(str, optional): Huggingface address of the tokenizer to use. If not provided, will attempt to search for tokenizer packaged with model. If using a custom model, provide the path to the tokenizer directory.--disable_special_tokens(bool, optional): When True, PEPE disables pre- and appending BOS/CLS and EOS/SEP tokens before embedding. Default isFalse.--device(str, optional): Device to run the model on. Choose fromcuda,cpu, or specific GPU indices likecuda:0,cuda:1. Default iscuda.
Embedding Configuration
--layers(str, optional): Representation layers to extract from the model. Default is the last layer. Example:--layers -1 6.--extract_embeddings(str, optional): Set the embedding return types. Choose one or more from:per_token: Extracts embeddings for each token (amino acid) in the sequence. Output shape:(num_sequences, max_length, embedding_size).mean_pooled: Computes the average embedding across all tokens in a sequence, excluding special tokens (BOS, EOS, padding). Output shape:(num_sequences, embedding_size).substring_pooled: Computes the average embedding for a specific substring within each sequence (e.g., a CDR3 region). Requires--substring_path. Output shape:(num_sequences, embedding_size).attention_head: Extracts raw attention weights for every individual head in the specified layers. Output shape:(num_sequences, max_length, max_length)per head.attention_layer: Extracts the average attention weights across all heads within each specified layer. Output shape:(num_sequences, max_length, max_length)per layer.attention_model: Extracts the average attention weights across all heads and all specified layers. Output shape:(num_sequences, max_length, max_length).logits: Extracts the raw language model output (logits). (Experimental) Default ismean_pooled.
--substring_path(str, optional): Path to a CSV file with columns "sequence_id" and "substring". Only required when selecting "substring_pooled" option.--context(int, optional): Only specify when including "substring_pooled" in--extract_embeddingsoption. Number of amino acids to include before and after the substring sequence. Default is0.
Processing Configuration
--batch_size(int, optional): Batch size for loading sequences. Default is1024. Decrease if encountering out-of-memory errors.--max_length(int, optional): Length to which sequences will be padded. Default is length of longest sequence in input file + special token(s). If shorter than longest sequence, will forcefully default to length of longest sequence + special token(s).--split_long_sequences(bool, optional): When True, automatically detect sequences exceeding the model's maximum allowed length and split them into chunks for processing. Default isFalse.--split_overlap(int, optional): Number of tokens to overlap when splitting long sequences. This helps maintain context across chunk boundaries. Default is0.--force_split_length(int, optional): Explicitly force sequence splitting at a specific length, overriding the model's auto-detected limits. Default isNone.--discard_padding(bool, optional): Discard padding tokens from per_token embeddings output. Note: Setting this toTruewill automatically disable--streaming_output. Default isFalse.
Output Configuration
--experiment_name(str, optional): Prefix for names of output files. If not provided, name of input file will be used for prefix.--streaming_output(bool, optional): PEPE preallocates the required disk space and writes each batch of outputs concurrently. Can pose issues with file systems that do not support memory mapping (such as some distributed file systems.) When False, all outputs are stored in RAM and written to disk at once after computation has finished. Note: Automatically disabled if--discard_paddingisTrue. Default isTrue.--precision(str, optional): Precision of the output data. Choose fromfloat16,16,half,float32,32,full. Inference during embedding is not affected. Default isfloat32.--flatten(bool, optional): Flatten 2D output arrays (per_token embeddings or attention weights) to 1D arrays per input sequence. Default isFalse.
Performance Configuration
--num_workers(int, optional): Number of workers for asynchronous data writing. Only relevant when--streaming_outputis enabled. Default is8.--flush_batches_after(int, optional): Size (in MB) of outputs to accumulate in RAM per worker before flushing to disk. Default is128.
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file pepe_cli-1.3.0.tar.gz.
File metadata
- Download URL: pepe_cli-1.3.0.tar.gz
- Upload date:
- Size: 40.0 MB
- Tags: Source
- Uploaded using Trusted Publishing? Yes
- Uploaded via: twine/6.1.0 CPython/3.13.12
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
16af0e23ccd6f01bcf02167fe55287c2543103d07d7e9e5722b50ab9af44b109
|
|
| MD5 |
567c789d5ef5e513f6fba2343d391162
|
|
| BLAKE2b-256 |
3465d59e671ee3cad27fdcd970b9f85ae99e070018fcf7342c2c23a68ec3a239
|
Provenance
The following attestation bundles were made for pepe_cli-1.3.0.tar.gz:
Publisher:
publish-main-branch-trusted.yml on csi-greifflab/pepe-cli
-
Statement:
-
Statement type:
https://in-toto.io/Statement/v1 -
Predicate type:
https://docs.pypi.org/attestations/publish/v1 -
Subject name:
pepe_cli-1.3.0.tar.gz -
Subject digest:
16af0e23ccd6f01bcf02167fe55287c2543103d07d7e9e5722b50ab9af44b109 - Sigstore transparency entry: 2098491785
- Sigstore integration time:
-
Permalink:
csi-greifflab/pepe-cli@32460902a75382c00ba1c61c13ad04df86949a00 -
Branch / Tag:
refs/heads/main - Owner: https://github.com/csi-greifflab
-
Access:
public
-
Token Issuer:
https://token.actions.githubusercontent.com -
Runner Environment:
github-hosted -
Publication workflow:
publish-main-branch-trusted.yml@32460902a75382c00ba1c61c13ad04df86949a00 -
Trigger Event:
push
-
Statement type:
File details
Details for the file pepe_cli-1.3.0-py3-none-any.whl.
File metadata
- Download URL: pepe_cli-1.3.0-py3-none-any.whl
- Upload date:
- Size: 56.9 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? Yes
- Uploaded via: twine/6.1.0 CPython/3.13.12
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
7025b84c27185deae5c296fa95febdaf61835a71c89d6995e9d9299028b08bf0
|
|
| MD5 |
5e07d44ea2b874dcd53c2d000cdc460b
|
|
| BLAKE2b-256 |
ae3ea1636e0b1e911297852b9d962afaebc99bc1c2c8dcc677868e33283e00da
|
Provenance
The following attestation bundles were made for pepe_cli-1.3.0-py3-none-any.whl:
Publisher:
publish-main-branch-trusted.yml on csi-greifflab/pepe-cli
-
Statement:
-
Statement type:
https://in-toto.io/Statement/v1 -
Predicate type:
https://docs.pypi.org/attestations/publish/v1 -
Subject name:
pepe_cli-1.3.0-py3-none-any.whl -
Subject digest:
7025b84c27185deae5c296fa95febdaf61835a71c89d6995e9d9299028b08bf0 - Sigstore transparency entry: 2098492059
- Sigstore integration time:
-
Permalink:
csi-greifflab/pepe-cli@32460902a75382c00ba1c61c13ad04df86949a00 -
Branch / Tag:
refs/heads/main - Owner: https://github.com/csi-greifflab
-
Access:
public
-
Token Issuer:
https://token.actions.githubusercontent.com -
Runner Environment:
github-hosted -
Publication workflow:
publish-main-branch-trusted.yml@32460902a75382c00ba1c61c13ad04df86949a00 -
Trigger Event:
push
-
Statement type: