Skip to main content

phamclust

PhamClust is a tool for performing gene phamily based clustering of bacteriophage genomes. It makes use of a novel genome similarity index, the proteomic equivalence quotient (PEQ) to cluster genomes according to their global similarity. It was published in mSphere in 2023.

Installation

The most straightforward way to install PhamClust is from the Python Package Index (PyPI): pip install phamclust

Usage

Once installed, invoking phamclust at the commandline with no arguments will display the help menu:

(phamclust) chg60 % phamclust
usage: phamclust [-h] [-g] [-k] [-s] [-sl] [-c] [-cl] [-nr] [-nl] [-m] [-d] [-n] [-r] [-t] infile outdir

Cluster phage genomes using gene content similarity-based metrics.

positional arguments:
  infile                path to a TSV file mapping genomes to phams and translations
  outdir                path to which output files should be written

options:
  -h, --help            show this help message and exit
  -g, --genome-dir      interpret `infile` as a directory of genome FASTA files instead of TSV
  -d, --debug           increase verbosity of logging for debug purposes
  -n, --no-sub          do not perform sub-clustering
  -r, --remove-tmp      remove temporary files (not recommended if repeated runs are planned on the same dataset)
  -t , --threads        number of CPU cores to use [default: 16]

clustering arguments:
  -k , --k-min          minimum cluster size to perform subclustering [default: 6]
  -s , --sub-thresh     similarity threshold to use for sub-clustering [default: 0.6]
  -sl , --sub-linkage   linkage type to use for sub-clustering [default: single]
  -c , --clu-thresh     similarity threshold to use for clustering [default: 0.25]
  -cl , --clu-linkage   linkage type to use for clustering [default: average]
  -nr , --nr-thresh     similarity threshold above which to pre-group very similar genomes that must be clustered together [default: 0.75]
  -nl , --nr-linkage    linkage type to use for pre-grouping very similar genomes [default: complete]
  -m , --metric         relatedness index to use for pairwise genome comparisons [default: peq]
  
heatmap arguments:
  -hc , --heatmap-colors
                        comma-separated list of 2 or 3 colors to use in heatmaps [default: red,yellow,green]
  -hm , --heatmap-midpoint
                        midpoint to use for color gradient in heatmaps [default: same as clustering threshold]

Available metrics:

    Acronym     Name                                Reference
(1) gcs         gene content similarity             https://doi.org/10.1038/nmicrobiol.2017.112
(2) jc          jaccard coefficient                 https://doi.org/10.1111/j.1469-8137.1912.tb05611.x
(3) pocp        percentage of conserved proteins    https://doi.org/10.1128/JB.01688-14
(4) af          alignment fraction                  https://doi.org/10.1093/nar/gkv657
(5) aai         average aminoacid identity          https://doi.org/10.1073/pnas.0409727102
(6) peq         proteomic equivalence quotient      https://doi.org/10.1128/msystems.00443-23

PhamClust takes an input filepath and an output filepath as its primary arguments. By default, the input path is assumed to be a TSV file mapping genome names/identifiers to pham identifiers and translations.

If the -g/--genome-dir argument is provided, PhamClust interprets the input filepath as a directory containing one FASTA file per genome, with headers structured as in the example below:

>name=Bipper|pham=pham_1|n=1
MTAPLLQSVTADDGNMITVPTLQFTRWLDETRDKVIGADGAPDPVRDPMSAYRYLKGRRSVIEGAARQRPMLRLFDKNMDPIAQIAGERLASVEEMMSDSGQANVVLRYDNWLTDFILHQTKIHEDLHLVVDPNPTNRTWRTRWGGKITGINAKRDSSGIHTLELEAISNRQHAKHMLFASNPVFPPEIQLPKMWVLPGNTRTILSISMFVNLARRFFPLLSIPTNIFNPMAWVNGWGAGLDPLMWPLQVAFVNPLLDQSRLSVLGSSWTDWHTAMDSMLKDAGVLFRAYTWLTEDADTPHTELVDMVRGLGPLQDTVDNLTRPHRNCVVFALEDKSGVQGPTGTAADGVINLIGATADDMITETLFNLDRDGDGETDPIFRKLLGVAPEKPKTIWYDGQFSGIIESEIRRHKGPVKKIHTGGRSPSILNQAQTYAIRYALSQLAQVISYGIGAYQQYGTEGLDNLYQGQLDNTLFAWQAFDDPIRALQTGDMAWQEHFERGSGTAYTLSGIVTLRVGHYKTRAWQGFTVKVVNGRPHAVDVDITLGDRAGFEQGGIIFVDQITAIKRSWSRTEPVTVQLSIGDDQDKEDPAARGLRAIQAVWTTLGMLLGEGTIF
>name=Bipper|pham=pham_37|n=1
MTSPSGVAVAALKGHTKPRLYTPPLAVNCNIWIAPELSCPCGCGLHAGTSWGFDCIDFLTNVLKWQLIPYQRWLYIHALEKGPGGEGFRFKTLVILIARQNGKTQWLRGLGLWRLYLDSRGRSSPDCPAAKTVVIAAQGLEYAEGTLGEVVNDVKECRALKREFLRHRQTNGKHAMLLSGRRSWRAVAANRKGGRSMSVDLAELDELREHHDWLAWNAITPTTQARQYSQNVAASNAGDKRSVVLRSLRDGAMAKILARDTEDTKTGLFEYSAPQDANPLERKYWPMANPALGYLPGHDEDALAAKAEAMADNMAGFVTEHLCQWVDTLLPGVMPMEDWNATTDPESRRAEGAPVYAAVDVSHSRSKAYIAVASRRSDGLLHVEVVAAHRGTDWVVPWFKARPGKFVAVAVQARGCPASDLIEPLTEAGVPVMELGGAELVRGAGGVLFDGIRKHAIWHRPSPALDTAAKGTVSRSLGGDTWVLDRKNSPVDAAPLVACAAAAWAEGQGPMVPDKVPEVHEWPDEEEIAEWEKELDELQ
...

If a genome encodes more than one copy of a pham (namely, paralogs), each copy after the first should increment the value of n.

Six metrics are available for calculating intergenomic similarities (processing speeds estimated in parentheses as the number of genome pairs calculated per second on an M1 Macbook Pro):

  1. Gene Content Similarity (gcs) (>100,000 pairs/second)
  2. Jaccard Coefficient (jc) (>55,000 pairs/second)
  3. Percentage of Conserved Proteins (pocp) (>25,000 pairs/second)
  4. Alignment Fraction (AF) (>15,000 pairs/second)
  5. Average Aminoacid Identity (aai) (~500 pairs/second)
  6. Proteomic Equivalence Quotient (peq) (~475 pairs/second)

Because of how cheap the first four metrics are, the maximum parallelization benefit is seen with just 4 CPU cores for datasets consisting of fewer than 2,500 genomes. The last two metrics are considerably more expensive to calculate, and will see benefit from as many physical cores are available on your machine (i.e., core count, not thread count), as long as there is enough system memory.

Heatmap settings

Among the outputs from PhamClust are per-cluster matrix heatmaps that nicely illustrate the pairwise similarities within clusters/subclusters.

For reasonably small datasets (those with fewer than 1000 genomes), a heatmap will also be drawn for the complete dataset matrix.

Two commandline arguments can be used to alter the appearance of these heatmaps. The -hc/--heatmap-colors argument allows you to specify either two or three colors that define the heatmap colorscheme. By default, a 3-point gradient is used, where the lowest similarity genome pairs are in red, intermediate similarity genomes pairs are in yellow, and the highest-similarity genome pairs are green. This default behavior is the same as invoking phamclust with -hc red,yellow,green. Another visually appealing option might be a 2-color gradient from white (0% similar) to green (100% identical), which could be applied with -hc white,green.

Any valid CSS named colors can be used:

            aliceblue, antiquewhite, aqua, aquamarine, azure,
            beige, bisque, black, blanchedalmond, blue,
            blueviolet, brown, burlywood, cadetblue,
            chartreuse, chocolate, coral, cornflowerblue,
            cornsilk, crimson, cyan, darkblue, darkcyan,
            darkgoldenrod, darkgray, darkgrey, darkgreen,
            darkkhaki, darkmagenta, darkolivegreen, darkorange,
            darkorchid, darkred, darksalmon, darkseagreen,
            darkslateblue, darkslategray, darkslategrey,
            darkturquoise, darkviolet, deeppink, deepskyblue,
            dimgray, dimgrey, dodgerblue, firebrick,
            floralwhite, forestgreen, fuchsia, gainsboro,
            ghostwhite, gold, goldenrod, gray, grey, green,
            greenyellow, honeydew, hotpink, indianred, indigo,
            ivory, khaki, lavender, lavenderblush, lawngreen,
            lemonchiffon, lightblue, lightcoral, lightcyan,
            lightgoldenrodyellow, lightgray, lightgrey,
            lightgreen, lightpink, lightsalmon, lightseagreen,
            lightskyblue, lightslategray, lightslategrey,
            lightsteelblue, lightyellow, lime, limegreen,
            linen, magenta, maroon, mediumaquamarine,
            mediumblue, mediumorchid, mediumpurple,
            mediumseagreen, mediumslateblue, mediumspringgreen,
            mediumturquoise, mediumvioletred, midnightblue,
            mintcream, mistyrose, moccasin, navajowhite, navy,
            oldlace, olive, olivedrab, orange, orangered,
            orchid, palegoldenrod, palegreen, paleturquoise,
            palevioletred, papayawhip, peachpuff, peru, pink,
            plum, powderblue, purple, red, rosybrown,
            royalblue, saddlebrown, salmon, sandybrown,
            seagreen, seashell, sienna, silver, skyblue,
            slateblue, slategray, slategrey, snow, springgreen,
            steelblue, tan, teal, thistle, tomato, turquoise,
            violet, wheat, white, whitesmoke, yellow,
            yellowgreen

For 3-point color scales, the -hm/--heatmap-midpoint argument can be used to adjust the similarity threshold where the middle color goes. For example, to highlight diversity within clusters (i.e., dissimilarity between subclusters), a midpoint at the subcluster threshold would maximize contrast between intra-subcluster and inter-subcluster similarity values.

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

phamclust-1.3.3.tar.gz (47.4 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

phamclust-1.3.3-py3-none-any.whl (51.6 kB view details)

Uploaded Python 3

File details

Details for the file phamclust-1.3.3.tar.gz.

File metadata

  • Download URL: phamclust-1.3.3.tar.gz
  • Upload date:
  • Size: 47.4 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/5.0.0 CPython/3.8.18

File hashes

Hashes for phamclust-1.3.3.tar.gz
Algorithm Hash digest
SHA256 d4c767c57e88dc3adeba8728bbf99aaec07ef783ede26b6e10b3c7ee978ec459
MD5 4ed9b3b5fd6d10b7157b871d4363c39a
BLAKE2b-256 796f108b75322e932e1144d355957d4f50ed8da0f1cd6241291a85ca94c90e11

See more details on using hashes here.

File details

Details for the file phamclust-1.3.3-py3-none-any.whl.

File metadata

  • Download URL: phamclust-1.3.3-py3-none-any.whl
  • Upload date:
  • Size: 51.6 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/5.0.0 CPython/3.8.18

File hashes

Hashes for phamclust-1.3.3-py3-none-any.whl
Algorithm Hash digest
SHA256 44f36d07325b8cd2372e6f8f5d9ea2022b2f55db830ac03172799c102b8d84c8
MD5 a2ec781f5a8ee632585db485904e0265
BLAKE2b-256 507453c8fb81054e57200448b29796db252fb795ecc32332a706a02ed1e0f489

See more details on using hashes here.

Release history Release notifications | RSS feed

This release

1.3.3 This release

2 files

1.3.2

2 files

1.3.1

2 files

1.3.0

2 files

1.2.0

2 files

1.1.0

2 files

1.0.1

2 files

1.0.0

2 files

0.1.3

2 files

0.1.2

2 files

0.1.1

2 files

0.1.0

2 files

Anthropic, PBC Visionary sponsor Bloomberg Visionary sponsor Hudson River Trading Visionary sponsor Meta Visionary sponsor NVIDIA Visionary sponsor Microsoft Sustainability sponsor Depot Continuous Integration AWS Cloud computing and Security Sponsor Datadog Monitoring Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page