Skip to main content

pip installable proteinmpnn

Project description

ProteinMPNN

ProteinMPNN Read ProteinMPNN paper.

To run ProteinMPNN clone this github repo and install Python>=3.0, PyTorch, Numpy.

Full protein backbone models: vanilla_model_weights/v_48_002.pt, v_48_010.pt, v_48_020.pt, v_48_030.pt, soluble_model_weights/v_48_010.pt, v_48_020.pt.

CA only models: ca_model_weights/v_48_002.pt, v_48_010.pt, v_48_020.pt. Enable flag --ca_only to use these models.

Helper scripts: helper_scripts - helper functions to parse PDBs, assign which chains to design, which residues to fix, adding AA bias, tying residues etc.

Code organization:

  • protein_mpnn_run.py - the main script to initialialize and run the model.
  • protein_mpnn_utils.py - utility functions for the main script.
  • examples/ - simple code examples.
  • inputs/ - input PDB files for examples
  • outputs/ - outputs from examples
  • colab_notebooks/ - Google Colab examples
  • training/ - code and data to retrain the model

Input flags for protein_mpnn_run.py:

    argparser.add_argument("--suppress_print", type=int, default=0, help="0 for False, 1 for True")
    argparser.add_argument("--ca_only", action="store_true", default=False, help="Parse CA-only structures and use CA-only models (default: false)")
    argparser.add_argument("--path_to_model_weights", type=str, default="", help="Path to model weights folder;")
    argparser.add_argument("--model_name", type=str, default="v_48_020", help="ProteinMPNN model name: v_48_002, v_48_010, v_48_020, v_48_030; v_48_010=version with 48 edges 0.10A noise")
    argparser.add_argument("--use_soluble_model", action="store_true", default=False, help="Flag to load ProteinMPNN weights trained on soluble proteins only.")
    argparser.add_argument("--seed", type=int, default=0, help="If set to 0 then a random seed will be picked;")
    argparser.add_argument("--save_score", type=int, default=0, help="0 for False, 1 for True; save score=-log_prob to npy files")
    argparser.add_argument("--path_to_fasta", type=str, default="", help="score provided input sequence in a fasta format; e.g. GGGGGG/PPPPS/WWW for chains A, B, C sorted alphabetically and separated by /")
    argparser.add_argument("--save_probs", type=int, default=0, help="0 for False, 1 for True; save MPNN predicted probabilites per position")
    argparser.add_argument("--score_only", type=int, default=0, help="0 for False, 1 for True; score input backbone-sequence pairs")
    argparser.add_argument("--conditional_probs_only", type=int, default=0, help="0 for False, 1 for True; output conditional probabilities p(s_i given the rest of the sequence and backbone)")
    argparser.add_argument("--conditional_probs_only_backbone", type=int, default=0, help="0 for False, 1 for True; if true output conditional probabilities p(s_i given backbone)")
    argparser.add_argument("--unconditional_probs_only", type=int, default=0, help="0 for False, 1 for True; output unconditional probabilities p(s_i given backbone) in one forward pass")
    argparser.add_argument("--backbone_noise", type=float, default=0.00, help="Standard deviation of Gaussian noise to add to backbone atoms")
    argparser.add_argument("--num_seq_per_target", type=int, default=1, help="Number of sequences to generate per target")
    argparser.add_argument("--batch_size", type=int, default=1, help="Batch size; can set higher for titan, quadro GPUs, reduce this if running out of GPU memory")
    argparser.add_argument("--max_length", type=int, default=200000, help="Max sequence length")
    argparser.add_argument("--sampling_temp", type=str, default="0.1", help="A string of temperatures, 0.2 0.25 0.5. Sampling temperature for amino acids. Suggested values 0.1, 0.15, 0.2, 0.25, 0.3. Higher values will lead to more diversity.")
    argparser.add_argument("--out_folder", type=str, help="Path to a folder to output sequences, e.g. /home/out/")
    argparser.add_argument("--pdb_path", type=str, default='', help="Path to a single PDB to be designed")
    argparser.add_argument("--pdb_path_chains", type=str, default='', help="Define which chains need to be designed for a single PDB ")
    argparser.add_argument("--jsonl_path", type=str, help="Path to a folder with parsed pdb into jsonl")
    argparser.add_argument("--chain_id_jsonl",type=str, default='', help="Path to a dictionary specifying which chains need to be designed and which ones are fixed, if not specied all chains will be designed.")
    argparser.add_argument("--fixed_positions_jsonl", type=str, default='', help="Path to a dictionary with fixed positions")
    argparser.add_argument("--omit_AAs", type=list, default='X', help="Specify which amino acids should be omitted in the generated sequence, e.g. 'AC' would omit alanine and cystine.")
    argparser.add_argument("--bias_AA_jsonl", type=str, default='', help="Path to a dictionary which specifies AA composion bias if neededi, e.g. {A: -1.1, F: 0.7} would make A less likely and F more likely.")
    argparser.add_argument("--bias_by_res_jsonl", default='', help="Path to dictionary with per position bias.")
    argparser.add_argument("--omit_AA_jsonl", type=str, default='', help="Path to a dictionary which specifies which amino acids need to be omited from design at specific chain indices")
    argparser.add_argument("--pssm_jsonl", type=str, default='', help="Path to a dictionary with pssm")
    argparser.add_argument("--pssm_multi", type=float, default=0.0, help="A value between [0.0, 1.0], 0.0 means do not use pssm, 1.0 ignore MPNN predictions")
    argparser.add_argument("--pssm_threshold", type=float, default=0.0, help="A value between -inf + inf to restric per position AAs")
    argparser.add_argument("--pssm_log_odds_flag", type=int, default=0, help="0 for False, 1 for True")
    argparser.add_argument("--pssm_bias_flag", type=int, default=0, help="0 for False, 1 for True")
    argparser.add_argument("--tied_positions_jsonl", type=str, default='', help="Path to a dictionary with tied positions")


For example to make a conda environment to run ProteinMPNN:

  • conda create --name mlfold - this creates conda environment called mlfold
  • source activate mlfold - this activate environment
  • conda install pytorch torchvision torchaudio cudatoolkit=11.3 -c pytorch - install pytorch following steps from https://pytorch.org/

These are provided examples/:

  • submit_example_1.sh - simple monomer example
  • submit_example_2.sh - simple multi-chain example
  • submit_example_3.sh - directly from the .pdb path
  • submit_example_3_score_only.sh - return score only (model's uncertainty)
  • submit_example_3_score_only_from_fasta.sh - return score only (model's uncertainty) loading sequence from fasta files
  • submit_example_4.sh - fix some residue positions
  • submit_example_4_non_fixed.sh - specify which positions to design
  • submit_example_5.sh - tie some positions together (symmetry)
  • submit_example_6.sh - homooligomer example
  • submit_example_7.sh - return sequence unconditional probabilities (PSSM like)
  • submit_example_8.sh - add amino acid bias

Output example:

>3HTN, score=1.1705, global_score=1.2045, fixed_chains=['B'], designed_chains=['A', 'C'], model_name=v_48_020, git_hash=015ff820b9b5741ead6ba6795258f35a9c15e94b, seed=37
NMYSYKKIGNKYIVSINNHTEIVKALNAFCKEKGILSGSINGIGAIGELTLRFFNPKTKAYDDKTFREQMEISNLTGNISSMNEQVYLHLHITVGRSDYSALAGHLLSAIQNGAGEFVVEDYSERISRTYNPDLGLNIYDFER/NMYSYKKIGNKYIVSINNHTEIVKALNAFCKEKGILSGSINGIGAIGELTLRFFNPKTKAYDDKTFREQMEISNLTGNISSMNEQVYLHLHITVGRSDYSALAGHLLSAIQNGAGEFVVEDYSERISRTYNPDLGLNIYDFER
>T=0.1, sample=1, score=0.7291, global_score=0.9330, seq_recovery=0.5736
NMYSYKKIGNKYIVSINNHTEIVKALKKFCEEKNIKSGSVNGIGSIGSVTLKFYNLETKEEELKTFNANFEISNLTGFISMHDNKVFLDLHITIGDENFSALAGHLVSAVVNGTCELIVEDFNELVSTKYNEELGLWLLDFEK/NMYSYKKIGNKYIVSINNHTDIVTAIKKFCEDKKIKSGTINGIGQVKEVTLEFRNFETGEKEEKTFKKQFTISNLTGFISTKDGKVFLDLHITFGDENFSALAGHLISAIVDGKCELIIEDYNEEINVKYNEELGLYLLDFNK
>T=0.1, sample=2, score=0.7414, global_score=0.9355, seq_recovery=0.6075
NMYKYKKIGNKYIVSINNHTEIVKAIKEFCKEKNIKSGTINGIGQVGKVTLRFYNPETKEYTEKTFNDNFEISNLTGFISTYKNEVFLHLHITFGKSDFSALAGHLLSAIVNGICELIVEDFKENLSMKYDEKTGLYLLDFEK/NMYKYKKIGNKYVVSINNHTEIVEALKAFCEDKKIKSGTVNGIGQVSKVTLKFFNIETKESKEKTFNKNFEISNLTGFISEINGEVFLHLHITIGDENFSALAGHLLSAVVNGEAILIVEDYKEKVNRKYNEELGLNLLDFNL
  • score - average over residues that were designed negative log probability of sampled amino acids
  • global score - average over all residues in all chains negative log probability of sampled/fixed amino acids
  • fixed_chains - chains that were not designed (fixed)
  • designed_chains - chains that were redesigned
  • model_name/CA_model_name - model name that was used to generate results, e.g. v_48_020
  • git_hash - github version that was used to generate outputs
  • seed - random seed
  • T=0.1 - temperature equal to 0.1 was used to sample sequences
  • sample - sequence sample number 1, 2, 3...etc

@article{dauparas2022robust,
  title={Robust deep learning--based protein sequence design using ProteinMPNN},
  author={Dauparas, Justas and Anishchenko, Ivan and Bennett, Nathaniel and Bai, Hua and Ragotte, Robert J and Milles, Lukas F and Wicky, Basile IM and Courbet, Alexis and de Haas, Rob J and Bethel, Neville and others},
  journal={Science},
  volume={378},
  number={6615},  
  pages={49--56},
  year={2022},
  publisher={American Association for the Advancement of Science}
}

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

protein_mpnn_pip-0.0.1.tar.gz (44.2 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

protein_mpnn_pip-0.0.1-py3-none-any.whl (50.2 kB view details)

Uploaded Python 3

File details

Details for the file protein_mpnn_pip-0.0.1.tar.gz.

File metadata

  • Download URL: protein_mpnn_pip-0.0.1.tar.gz
  • Upload date:
  • Size: 44.2 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/4.0.2 CPython/3.10.9

File hashes

Hashes for protein_mpnn_pip-0.0.1.tar.gz
Algorithm Hash digest
SHA256 8e30ceaf49e64fd4672dbfa4dc76fb953443ba5bfbe95623e27489bbcabc2f9e
MD5 1fe1df862b6389bd724f01f4a01a9479
BLAKE2b-256 e0f0bc0f9bcea62ae1d63b9efa5f527d46191313139e8a0292b5f6ab44ddd8e6

See more details on using hashes here.

File details

Details for the file protein_mpnn_pip-0.0.1-py3-none-any.whl.

File metadata

File hashes

Hashes for protein_mpnn_pip-0.0.1-py3-none-any.whl
Algorithm Hash digest
SHA256 f84513169349346703c5eba442ad5e3cad237443311659acf340fe2548befa02
MD5 2ce1c2057cbe7b52ef2c17f85d7a9f2d
BLAKE2b-256 294c333682c61f52ea305c4fc24e661becc054f34f483bd2edafe400e5f0afad

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page