Skip to main content

ProteinMPNN

ProteinMPNN Read ProteinMPNN paper.

"pip install proteinmpnn"

Requires Python >=3.9, <3.13

# Example usage
proteinmpnn --out-folder outdir --pdb-path foo.pdb
proteinmpnn --out-folder outdir --pdb-path foo.pdb --use-soluble-model
proteinmpnn --out-folder outdir --jsonl_path bar.jsonl

See original repo https://github.com/dauparas/ProteinMPNN for more examples and code for retraining.

Helper scripts: helper_scripts - helper functions to parse PDBs, assign which chains to design, which residues to fix, adding AA bias, tying residues etc.

Code organization:

  • protein_mpnn_run.py - the main script to initialialize and run the model.
  • protein_mpnn_utils.py - utility functions for the main script.

Input flags for protein_mpnn_run.py:

    argparser.add_argument("--suppress_print", type=int, default=0, help="0 for False, 1 for True")
    argparser.add_argument("--ca_only", action="store_true", default=False, help="Parse CA-only structures and use CA-only models (default: false)")
    argparser.add_argument("--path_to_model_weights", type=str, default="", help="Path to model weights folder;")
    argparser.add_argument("--model_name", type=str, default="v_48_020", help="ProteinMPNN model name: v_48_002, v_48_010, v_48_020, v_48_030; v_48_010=version with 48 edges 0.10A noise")
    argparser.add_argument("--use_soluble_model", action="store_true", default=False, help="Flag to load ProteinMPNN weights trained on soluble proteins only.")
    argparser.add_argument("--seed", type=int, default=0, help="If set to 0 then a random seed will be picked;")
    argparser.add_argument("--save_score", type=int, default=0, help="0 for False, 1 for True; save score=-log_prob to npy files")
    argparser.add_argument("--path_to_fasta", type=str, default="", help="score provided input sequence in a fasta format; e.g. GGGGGG/PPPPS/WWW for chains A, B, C sorted alphabetically and separated by /")
    argparser.add_argument("--save_probs", type=int, default=0, help="0 for False, 1 for True; save MPNN predicted probabilites per position")
    argparser.add_argument("--score_only", type=int, default=0, help="0 for False, 1 for True; score input backbone-sequence pairs")
    argparser.add_argument("--conditional_probs_only", type=int, default=0, help="0 for False, 1 for True; output conditional probabilities p(s_i given the rest of the sequence and backbone)")
    argparser.add_argument("--conditional_probs_only_backbone", type=int, default=0, help="0 for False, 1 for True; if true output conditional probabilities p(s_i given backbone)")
    argparser.add_argument("--unconditional_probs_only", type=int, default=0, help="0 for False, 1 for True; output unconditional probabilities p(s_i given backbone) in one forward pass")
    argparser.add_argument("--backbone_noise", type=float, default=0.00, help="Standard deviation of Gaussian noise to add to backbone atoms")
    argparser.add_argument("--num_seq_per_target", type=int, default=1, help="Number of sequences to generate per target")
    argparser.add_argument("--batch_size", type=int, default=1, help="Batch size; can set higher for titan, quadro GPUs, reduce this if running out of GPU memory")
    argparser.add_argument("--max_length", type=int, default=200000, help="Max sequence length")
    argparser.add_argument("--sampling_temp", type=str, default="0.1", help="A string of temperatures, 0.2 0.25 0.5. Sampling temperature for amino acids. Suggested values 0.1, 0.15, 0.2, 0.25, 0.3. Higher values will lead to more diversity.")
    argparser.add_argument("--out_folder", type=str, help="Path to a folder to output sequences, e.g. /home/out/")
    argparser.add_argument("--pdb_path", type=str, default='', help="Path to a single PDB to be designed")
    argparser.add_argument("--pdb_path_chains", type=str, default='', help="Define which chains need to be designed for a single PDB ")
    argparser.add_argument("--jsonl_path", type=str, help="Path to a folder with parsed pdb into jsonl")
    argparser.add_argument("--chain_id_jsonl",type=str, default='', help="Path to a dictionary specifying which chains need to be designed and which ones are fixed, if not specied all chains will be designed.")
    argparser.add_argument("--fixed_positions_jsonl", type=str, default='', help="Path to a dictionary with fixed positions")
    argparser.add_argument("--omit_AAs", type=list, default='X', help="Specify which amino acids should be omitted in the generated sequence, e.g. 'AC' would omit alanine and cystine.")
    argparser.add_argument("--bias_AA_jsonl", type=str, default='', help="Path to a dictionary which specifies AA composion bias if neededi, e.g. {A: -1.1, F: 0.7} would make A less likely and F more likely.")
    argparser.add_argument("--bias_by_res_jsonl", default='', help="Path to dictionary with per position bias.")
    argparser.add_argument("--omit_AA_jsonl", type=str, default='', help="Path to a dictionary which specifies which amino acids need to be omited from design at specific chain indices")
    argparser.add_argument("--pssm_jsonl", type=str, default='', help="Path to a dictionary with pssm")
    argparser.add_argument("--pssm_multi", type=float, default=0.0, help="A value between [0.0, 1.0], 0.0 means do not use pssm, 1.0 ignore MPNN predictions")
    argparser.add_argument("--pssm_threshold", type=float, default=0.0, help="A value between -inf + inf to restric per position AAs")
    argparser.add_argument("--pssm_log_odds_flag", type=int, default=0, help="0 for False, 1 for True")
    argparser.add_argument("--pssm_bias_flag", type=int, default=0, help="0 for False, 1 for True")
    argparser.add_argument("--tied_positions_jsonl", type=str, default='', help="Path to a dictionary with tied positions")

Output example:

>3HTN, score=1.1705, global_score=1.2045, fixed_chains=['B'], designed_chains=['A', 'C'], model_name=v_48_020, git_hash=015ff820b9b5741ead6ba6795258f35a9c15e94b, seed=37
NMYSYKKIGNKYIVSINNHTEIVKALNAFCKEKGILSGSINGIGAIGELTLRFFNPKTKAYDDKTFREQMEISNLTGNISSMNEQVYLHLHITVGRSDYSALAGHLLSAIQNGAGEFVVEDYSERISRTYNPDLGLNIYDFER/NMYSYKKIGNKYIVSINNHTEIVKALNAFCKEKGILSGSINGIGAIGELTLRFFNPKTKAYDDKTFREQMEISNLTGNISSMNEQVYLHLHITVGRSDYSALAGHLLSAIQNGAGEFVVEDYSERISRTYNPDLGLNIYDFER
>T=0.1, sample=1, score=0.7291, global_score=0.9330, seq_recovery=0.5736
NMYSYKKIGNKYIVSINNHTEIVKALKKFCEEKNIKSGSVNGIGSIGSVTLKFYNLETKEEELKTFNANFEISNLTGFISMHDNKVFLDLHITIGDENFSALAGHLVSAVVNGTCELIVEDFNELVSTKYNEELGLWLLDFEK/NMYSYKKIGNKYIVSINNHTDIVTAIKKFCEDKKIKSGTINGIGQVKEVTLEFRNFETGEKEEKTFKKQFTISNLTGFISTKDGKVFLDLHITFGDENFSALAGHLISAIVDGKCELIIEDYNEEINVKYNEELGLYLLDFNK
>T=0.1, sample=2, score=0.7414, global_score=0.9355, seq_recovery=0.6075
NMYKYKKIGNKYIVSINNHTEIVKAIKEFCKEKNIKSGTINGIGQVGKVTLRFYNPETKEYTEKTFNDNFEISNLTGFISTYKNEVFLHLHITFGKSDFSALAGHLLSAIVNGICELIVEDFKENLSMKYDEKTGLYLLDFEK/NMYKYKKIGNKYVVSINNHTEIVEALKAFCEDKKIKSGTVNGIGQVSKVTLKFFNIETKESKEKTFNKNFEISNLTGFISEINGEVFLHLHITIGDENFSALAGHLLSAVVNGEAILIVEDYKEKVNRKYNEELGLNLLDFNL
  • score - average over residues that were designed negative log probability of sampled amino acids
  • global score - average over all residues in all chains negative log probability of sampled/fixed amino acids
  • fixed_chains - chains that were not designed (fixed)
  • designed_chains - chains that were redesigned
  • model_name/CA_model_name - model name that was used to generate results, e.g. v_48_020
  • git_hash - github version that was used to generate outputs
  • seed - random seed
  • T=0.1 - temperature equal to 0.1 was used to sample sequences
  • sample - sequence sample number 1, 2, 3...etc

@article{dauparas2022robust,
  title={Robust deep learning--based protein sequence design using ProteinMPNN},
  author={Dauparas, Justas and Anishchenko, Ivan and Bennett, Nathaniel and Bai, Hua and Ragotte, Robert J and Milles, Lukas F and Wicky, Basile IM and Courbet, Alexis and de Haas, Rob J and Bethel, Neville and others},
  journal={Science},
  volume={378},
  number={6615},  
  pages={49--56},
  year={2022},
  publisher={American Association for the Advancement of Science}
}

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

proteinmpnn-0.1.3.tar.gz (68.1 MB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

proteinmpnn-0.1.3-py3-none-any.whl (68.1 MB view details)

Uploaded Python 3

File details

Details for the file proteinmpnn-0.1.3.tar.gz.

File metadata

  • Download URL: proteinmpnn-0.1.3.tar.gz
  • Upload date:
  • Size: 68.1 MB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/6.0.1 CPython/3.12.2

File hashes

Hashes for proteinmpnn-0.1.3.tar.gz
Algorithm Hash digest
SHA256 c7b4a833cc63295f5ce99528efb96fcd372988d32db2650079d8d3a19a8adec1
MD5 ef11a97d14c1aa388254767276780284
BLAKE2b-256 8c5a7451c7db78ae19ef856b47c286fadb17a84269ea727e120b91d05e44d840

See more details on using hashes here.

File details

Details for the file proteinmpnn-0.1.3-py3-none-any.whl.

File metadata

  • Download URL: proteinmpnn-0.1.3-py3-none-any.whl
  • Upload date:
  • Size: 68.1 MB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/6.0.1 CPython/3.12.2

File hashes

Hashes for proteinmpnn-0.1.3-py3-none-any.whl
Algorithm Hash digest
SHA256 ddfb45a5f80b323a1c198bbdac3d4f13dc61ddd4693eaba8059d93f6506533f8
MD5 8145e7890897a2c3d516ae8c3781b9dc
BLAKE2b-256 9e45b0f1661eb702f07fb694cef08d0c23d6718de23108e6844dff877da3e1e6

See more details on using hashes here.

Release history Release notifications | RSS feed

This release

0.1.3 This release

2 files

0.1.2

2 files

Anthropic, PBC Visionary sponsor Bloomberg Visionary sponsor Hudson River Trading Visionary sponsor Meta Visionary sponsor NVIDIA Visionary sponsor Microsoft Sustainability sponsor Depot Continuous Integration AWS Cloud computing and Security Sponsor Datadog Monitoring Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page