Proteo
A simple Python library for working with UniProt, the Universal Protein resource.
Installation
pip install proteo
Usage
from proteo.uniprot import UniprotClient
# Initialize a client
u = UniprotClient()
# Use the get_protein method to retrieve a protein record by accession number
accession_number = "B5ZC00"
response = u.get_protein(accession_number)
# Protein data is returned as a dictionary
print(response['gene'])
#glyQS
print(response['recommended_name'])
#Glycine--tRNA ligase
print(response['sequence'])
#MKNKFKTQEELVNHLKTVGFVFANSEIYNGLANAWDYGPLGVLLKNNLKNLWWKEFVTKQKDVVGLDSAIILNPLVWKASGHLDNFSDPLIDCKNCKARYRADKLIESFDENIHIAENSSNEEFAKVLNDYEISCPTCKQFNWTEIRHFNLMFKTYQGVIEDAKNVVYLRPETAQGIFVNFKNVQRSMRLHLPFGIAQIGKSFRNEITPGNFIFRTREFEQMEIEFFLKEESAYDIFDKYLNQIENWLVSACGLSLNNLRKHEHPKEELSHYSKKTIDFEYNFLHGFSELYGIAYRTNYDLSVHMNLSKKDLTYFDEQTKEKYVPHVIEPSVGVERLLYAILTEATFIEKLENDDERILMDLKYDLAPYKIAVMPLVNKLKDKAEEIYGKILDLNISATFDNSGSIGKRYRRQDAIGTIYCLTIDFDSLDDQQDPSFTIRERNSMAQKRIKLSELPLYLNQKAHEDFQRQCQK
Response Dictionary
The protein response dictionary contains the following items:
| Key | Meaning |
|---|---|
| gene | The gene coding the protein |
| name | The protein's short name |
| organism | The organism in which the protein is found |
| primary_accession_number | The protein's UniProt accession number |
| recommended_name | The protein's long/recommended name |
| sequence | The amino acid sequence defining the protein |
Exceptions
Proteo defines the following exceptions:
| Exception | Meaning |
|---|---|
| proteo.exceptions.ProteinNotFoundError | Raised when no protein can be found for the accession number that was provided. |
1 maintainer
Metadata
1 maintainer
Release files for proteo 1.0.1
For a detailed explanation of source distributions (sdists) and built distributions (wheels), please see the package formats documentation.
Source distribution (sdist)
| File | Size | Uploaded | |
|---|---|---|---|
| proteo-1.0.1.tar.gz | 3.5 kB | Details |
Built distribution (wheel)
| File | Interpreter | ABI | Platform | Reset |
|---|---|---|---|---|
| proteo-1.0.1-py3-none-any.whl | Python 3 | none | any | Details |
Total release size: 8.7 kB
Release files / proteo-1.0.1.tar.gz
| Download URL | proteo-1.0.1.tar.gz |
|---|---|
| Size | 3.5 kB |
| Tags | Source |
|
SHA-256 checksum How to use checksums |
e1c2a49720804bd73febf83e8bd2d0c3032493ea443a3efe973d7198ef3b156e
|
|
BLAKE2b-256 checksum How to use checksums |
b0684bccd8a1ca4814429647d5f85c1cfe7a01a4c5badcda462aadad46fe5801
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/1.13.0 pkginfo/1.5.0.1 requests/2.21.0 setuptools/39.0.1 requests-toolbelt/0.9.1 tqdm/4.31.1 CPython/3.6.7
|
Release files / proteo-1.0.1-py3-none-any.whl
| Download URL | proteo-1.0.1-py3-none-any.whl |
|---|---|
| Size | 5.2 kB |
| Tags | Python 3 |
|
SHA-256 checksum How to use checksums |
cc722a93ae766a666c027543c3ec123a078667c135b4ddbd379c12a7db36930f
|
|
BLAKE2b-256 checksum How to use checksums |
fb081bd782bac92c9e73a553975c41266d13d8e568d639cdf83608265a3963f3
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/1.13.0 pkginfo/1.5.0.1 requests/2.21.0 setuptools/39.0.1 requests-toolbelt/0.9.1 tqdm/4.31.1 CPython/3.6.7
|
