Proteo
A simple Python library for working with UniProt, the Universal Protein resource.
Installation
pip install proteo
Usage
from proteo.uniprot import UniprotClient
# Initialize a client
u = UniprotClient()
# Use the get_protein method to retrieve a protein record by accession number
accession_number = "B5ZC00"
response = u.get_protein(accession_number)
# Protein data is returned as a dictionary
print(response['gene'])
#glyQS
print(response['recommended_name'])
#Glycine--tRNA ligase
print(response['sequence'])
#MKNKFKTQEELVNHLKTVGFVFANSEIYNGLANAWDYGPLGVLLKNNLKNLWWKEFVTKQKDVVGLDSAIILNPLVWKASGHLDNFSDPLIDCKNCKARYRADKLIESFDENIHIAENSSNEEFAKVLNDYEISCPTCKQFNWTEIRHFNLMFKTYQGVIEDAKNVVYLRPETAQGIFVNFKNVQRSMRLHLPFGIAQIGKSFRNEITPGNFIFRTREFEQMEIEFFLKEESAYDIFDKYLNQIENWLVSACGLSLNNLRKHEHPKEELSHYSKKTIDFEYNFLHGFSELYGIAYRTNYDLSVHMNLSKKDLTYFDEQTKEKYVPHVIEPSVGVERLLYAILTEATFIEKLENDDERILMDLKYDLAPYKIAVMPLVNKLKDKAEEIYGKILDLNISATFDNSGSIGKRYRRQDAIGTIYCLTIDFDSLDDQQDPSFTIRERNSMAQKRIKLSELPLYLNQKAHEDFQRQCQK
Response Dictionary
The protein response dictionary contains the following items:
| Key | Meaning |
|---|---|
| gene | The gene coding the protein |
| name | The protein's short name |
| organism | The organism in which the protein is found |
| primary_accession_number | The protein's UniProt accession number |
| recommended_name | The protein's long/recommended name |
| sequence | The amino acid sequence defining the protein |
Exceptions
Proteo defines the following exceptions:
| Exception | Meaning |
|---|---|
| proteo.exceptions.ProteinNotFoundError | Raised when no protein can be found for the accession number that was provided. |
1 maintainer
Metadata
1 maintainer
Release files for proteo 1.0.1
For a detailed explanation of source distributions (sdists) and built distributions (wheels), please see the package formats documentation.
Source distribution (sdist)
| File | Size | Uploaded | Provenance | Actions |
|---|---|---|---|---|
| proteo-1.0.1.tar.gz | 3.5 kB | Without provenance | Details for proteo-1.0.1.tar.gz |
Built distribution (wheel)
| File | Interpreter | ABI | Platform | Actions Reset |
|---|---|---|---|---|
| proteo-1.0.1-py3-none-any.whl | Python 3 | none | any | Details for proteo-1.0.1-py3-none-any.whl |
Total release size: 8.7 kB
Release files / proteo-1.0.1.tar.gz
| Download URL | proteo-1.0.1.tar.gz |
|---|---|
| Size | 3.5 kB |
| Tags | Source |
|
SHA-256 checksum How to use checksums |
e1c2a49720804bd73febf83e8bd2d0c3032493ea443a3efe973d7198ef3b156e
|
|
BLAKE2b-256 checksum How to use checksums |
b0684bccd8a1ca4814429647d5f85c1cfe7a01a4c5badcda462aadad46fe5801
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/1.13.0 pkginfo/1.5.0.1 requests/2.21.0 setuptools/39.0.1 requests-toolbelt/0.9.1 tqdm/4.31.1 CPython/3.6.7
|
Release files / proteo-1.0.1-py3-none-any.whl
| Download URL | proteo-1.0.1-py3-none-any.whl |
|---|---|
| Size | 5.2 kB |
| Tags | Python 3 |
|
SHA-256 checksum How to use checksums |
cc722a93ae766a666c027543c3ec123a078667c135b4ddbd379c12a7db36930f
|
|
BLAKE2b-256 checksum How to use checksums |
fb081bd782bac92c9e73a553975c41266d13d8e568d639cdf83608265a3963f3
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/1.13.0 pkginfo/1.5.0.1 requests/2.21.0 setuptools/39.0.1 requests-toolbelt/0.9.1 tqdm/4.31.1 CPython/3.6.7
|
Security for proteo 1.0.1
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
No provenance found
None of the files in this release were uploaded with provenance metadata.
A note on package security
PyPI is a repository for distributing packages, not a service for auditing them. While third-party security researchers and our staff do their best to detect and remove malicious packages, PyPI cannot guarantee the quality, security or suitability of any given package.
To learn more about protecting yourself from malicious actors, visit our package security documentation.
