A simple client library for UniProt
Project description
Proteo
A simple Python library for working with UniProt, the Universal Protein resource.
Installation
pip install proteo
Usage
from proteo.uniprot import UniprotClient
# Initialize a client
u = UniprotClient()
# Use the get_protein method to retrieve a protein record by accession number
accession_number = "B5ZC00"
response = u.get_protein(accession_number)
# Protein data is returned as a dictionary
print(response['gene'])
#glyQS
print(response['recommended_name'])
#Glycine--tRNA ligase
print(response['sequence'])
#MKNKFKTQEELVNHLKTVGFVFANSEIYNGLANAWDYGPLGVLLKNNLKNLWWKEFVTKQKDVVGLDSAIILNPLVWKASGHLDNFSDPLIDCKNCKARYRADKLIESFDENIHIAENSSNEEFAKVLNDYEISCPTCKQFNWTEIRHFNLMFKTYQGVIEDAKNVVYLRPETAQGIFVNFKNVQRSMRLHLPFGIAQIGKSFRNEITPGNFIFRTREFEQMEIEFFLKEESAYDIFDKYLNQIENWLVSACGLSLNNLRKHEHPKEELSHYSKKTIDFEYNFLHGFSELYGIAYRTNYDLSVHMNLSKKDLTYFDEQTKEKYVPHVIEPSVGVERLLYAILTEATFIEKLENDDERILMDLKYDLAPYKIAVMPLVNKLKDKAEEIYGKILDLNISATFDNSGSIGKRYRRQDAIGTIYCLTIDFDSLDDQQDPSFTIRERNSMAQKRIKLSELPLYLNQKAHEDFQRQCQK
Response Dictionary
The protein response dictionary contains the following items:
| Key | Meaning |
|---|---|
| gene | The gene coding the protein |
| name | The protein's short name |
| organism | The organism in which the protein is found |
| primary_accession_number | The protein's UniProt accession number |
| recommended_name | The protein's long/recommended name |
| sequence | The amino acid sequence defining the protein |
Exceptions
Proteo defines the following exceptions:
| Exception | Meaning |
|---|---|
| proteo.exceptions.ProteinNotFoundError | Raised when no protein can be found for the accession number that was provided. |
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
proteo-1.0.1.tar.gz
(3.5 kB
view details)
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file proteo-1.0.1.tar.gz.
File metadata
- Download URL: proteo-1.0.1.tar.gz
- Upload date:
- Size: 3.5 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/1.13.0 pkginfo/1.5.0.1 requests/2.21.0 setuptools/39.0.1 requests-toolbelt/0.9.1 tqdm/4.31.1 CPython/3.6.7
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
e1c2a49720804bd73febf83e8bd2d0c3032493ea443a3efe973d7198ef3b156e
|
|
| MD5 |
ce1ba181a08f09db8604b3a72132ea5c
|
|
| BLAKE2b-256 |
b0684bccd8a1ca4814429647d5f85c1cfe7a01a4c5badcda462aadad46fe5801
|
File details
Details for the file proteo-1.0.1-py3-none-any.whl.
File metadata
- Download URL: proteo-1.0.1-py3-none-any.whl
- Upload date:
- Size: 5.2 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/1.13.0 pkginfo/1.5.0.1 requests/2.21.0 setuptools/39.0.1 requests-toolbelt/0.9.1 tqdm/4.31.1 CPython/3.6.7
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
cc722a93ae766a666c027543c3ec123a078667c135b4ddbd379c12a7db36930f
|
|
| MD5 |
6092ce294c89a959308a3d5f33ffa155
|
|
| BLAKE2b-256 |
fb081bd782bac92c9e73a553975c41266d13d8e568d639cdf83608265a3963f3
|