Skip to main content

A simple client library for UniProt

Project description

Proteo

A simple Python library for working with UniProt, the Universal Protein resource.

Installation

pip install proteo

Usage

from proteo.uniprot import UniprotClient

# Initialize a client
u = UniprotClient()

# Use the get_protein method to retrieve a protein record by accession number
accession_number = "B5ZC00"
response = u.get_protein(accession_number)

# Protein data is returned as a dictionary
print(response['gene'])
#glyQS

print(response['recommended_name'])
#Glycine--tRNA ligase

print(response['sequence'])
#MKNKFKTQEELVNHLKTVGFVFANSEIYNGLANAWDYGPLGVLLKNNLKNLWWKEFVTKQKDVVGLDSAIILNPLVWKASGHLDNFSDPLIDCKNCKARYRADKLIESFDENIHIAENSSNEEFAKVLNDYEISCPTCKQFNWTEIRHFNLMFKTYQGVIEDAKNVVYLRPETAQGIFVNFKNVQRSMRLHLPFGIAQIGKSFRNEITPGNFIFRTREFEQMEIEFFLKEESAYDIFDKYLNQIENWLVSACGLSLNNLRKHEHPKEELSHYSKKTIDFEYNFLHGFSELYGIAYRTNYDLSVHMNLSKKDLTYFDEQTKEKYVPHVIEPSVGVERLLYAILTEATFIEKLENDDERILMDLKYDLAPYKIAVMPLVNKLKDKAEEIYGKILDLNISATFDNSGSIGKRYRRQDAIGTIYCLTIDFDSLDDQQDPSFTIRERNSMAQKRIKLSELPLYLNQKAHEDFQRQCQK

Response Dictionary

The protein response dictionary contains the following items:

Key Meaning
gene The gene coding the protein
name The protein's short name
organism The organism in which the protein is found
primary_accession_number The protein's UniProt accession number
recommended_name The protein's long/recommended name
sequence The amino acid sequence defining the protein

Exceptions

Proteo defines the following exceptions:

Exception Meaning
proteo.exceptions.ProteinNotFoundError Raised when no protein can be found for the accession number that was provided.

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

proteo-1.0.1.tar.gz (3.5 kB view hashes)

Uploaded source

Built Distribution

proteo-1.0.1-py3-none-any.whl (5.2 kB view hashes)

Uploaded py3

Supported by

AWS AWS Cloud computing Datadog Datadog Monitoring Facebook / Instagram Facebook / Instagram PSF Sponsor Fastly Fastly CDN Google Google Object Storage and Download Analytics Huawei Huawei PSF Sponsor Microsoft Microsoft PSF Sponsor NVIDIA NVIDIA PSF Sponsor Pingdom Pingdom Monitoring Salesforce Salesforce PSF Sponsor Sentry Sentry Error logging StatusPage StatusPage Status page