Skip to main content

Refua MCP Server

MCP server exposing strict, typed Refua tools for Boltz2 folding/affinity and BoltzGen design workflows.

Protocol target: MCP spec revision 2025-11-25.

Install

pip install refua[cuda] # remove [cuda] if you don't need gpu support
pip install refua-mcp

ADMET predictions are optional; install refua[admet] to enable them:

pip install refua[admet]

Clinical trial simulation is optional; install the clinical extra:

pip install "refua-mcp[clinical]"

Data catalog/query/source-validation tools are optional; install the data extra:

pip install "refua-mcp[data]"

Preclinical planning/scheduling/bioanalysis/CMC tools are optional; install the preclinical extra:

pip install "refua-mcp[preclinical]"

WetLab, benchmark, regulatory, and deployment tools are optional:

pip install "refua-mcp[wetlab,bench,regulatory,deploy]"

Install the full project tool surface with:

pip install "refua-mcp[ecosystem]"

OpenTelemetry spans/metrics are optional:

pip install "refua-mcp[observability]"

Boltz2 and BoltzGen require model/molecule assets. If you don't have them, refua can download them for you automatically:

python -c "from refua import download_assets; download_assets()"
  • Boltz2: uses ~/.boltz by default. Override via tool boltz.cache_dir if needed.
  • BoltzGen: uses the bundled HF artifact by default. Override via tool boltzgen.mol_dir if needed.

MCP Clients

Claude Code

Add the server to your Claude Code MCP config (macOS: ~/Library/Application Support/Claude/claude_code_config.json, Linux: ~/.config/claude/claude_code_config.json). This uses the default assets (~/.boltz for Boltz2 and the bundled BoltzGen artifact). Merge with any existing mcpServers entries:

{
  "mcpServers": {
    "refua-mcp": {
      "command": "python3",
      "args": ["-m", "refua_mcp.server"]
    }
  }
}

Codex

Register the server with the Codex CLI (uses default asset locations):

codex mcp add refua-mcp -- python3 -m refua_mcp.server

List configured servers with:

codex mcp list

If the server is slow to boot (for example on first import of heavy ML deps), raise the startup timeout in your Codex config.toml:

[mcp_servers.refua-mcp]
startup_timeout_sec = 30

Transport And Security

Default transport is stdio. You can run HTTP transports with runtime env vars:

REFUA_MCP_TRANSPORT=streamable-http python -m refua_mcp.server

Supported transport modes:

  • REFUA_MCP_TRANSPORT=stdio|sse|streamable-http
  • REFUA_MCP_HOST / REFUA_MCP_PORT
  • REFUA_MCP_MOUNT_PATH

Security/runtime controls:

  • REFUA_MCP_ENABLE_DNS_REBINDING_PROTECTION=true|false
  • REFUA_MCP_ALLOWED_HOSTS=host1,host2
  • REFUA_MCP_ALLOWED_ORIGINS=https://origin1,https://origin2
  • REFUA_MCP_AUTH_TOKENS=token1,token2 (static bearer tokens for HTTP transports)
  • REFUA_MCP_TASK_TIMEOUT_SECONDS
  • REFUA_MCP_QUEUE_TIMEOUT_SECONDS

Tools

  • refua_validate_spec: validate and normalize a request without running folding/affinity.
  • refua_fold: run fold/design workflows with typed entities and constraints.
  • refua_affinity: run affinity-only predictions.
  • refua_antibody_design: focused antibody entrypoint (antibody + optional context_entities).
  • refua_protein_properties: compute sequence-based protein properties via Refua's ProteinProperties API.
  • refua_data_list (optional): list datasets from refua-data catalog.
  • refua_data_fetch (optional): fetch one dataset into local cache.
  • refua_data_materialize (optional): materialize one dataset into parquet parts.
  • refua_data_query (optional): query filtered rows from materialized parquet data.
  • refua_data_validate_sources (optional): validate catalog source URLs/API endpoints.
  • refua_job: check status/results for background jobs.
  • refua_admet_profile (optional): run model-based ADMET predictions for SMILES strings (requires refua[admet]).
  • refua_clinical_simulator (optional): run the refua-clinical simulator and optional workup (requires refua-mcp[clinical]).
  • refua_preclinical_templates (optional): fetch default study + sample templates and curated references (requires refua-mcp[preclinical]).
  • refua_preclinical_plan (optional): generate GLP tox/pharmacology study planning payloads.
  • refua_preclinical_schedule (optional): generate in vivo operational schedules.
  • refua_preclinical_bioanalysis (optional): run bioanalytical ETL/QC and simple NCA summaries.
  • refua_preclinical_workup (optional): generate integrated preclinical workups with optional bioanalysis.
  • refua_preclinical_cmc_templates (optional): fetch CMC starter templates and references.
  • refua_preclinical_cmc_plan (optional): generate formulation/process/QbD/validation CMC planning outputs.
  • refua_preclinical_batch_record (optional): generate electronic batch record templates.
  • refua_preclinical_stability_plan (optional): generate stability study schedules.
  • refua_preclinical_stability_assess (optional): assess stability results against criteria.
  • refua_preclinical_release_assess (optional): evaluate release decisions from batch/stability evidence.
  • refua_wetlab_providers (optional): list wet-lab automation providers.
  • refua_wetlab_validate_protocol (optional): validate canonical wet-lab protocol payloads.
  • refua_wetlab_compile_protocol (optional): compile protocols for a provider.
  • refua_wetlab_run_protocol (optional): create dry-run or queued wet-lab protocol runs.
  • refua_wetlab_run_status (optional): list/fetch/cancel wet-lab runs and build run lineage.
  • refua_wetlab_lms_get / refua_wetlab_lms_post (optional): access the WetLab LMS resource API.
  • refua_bench_init, refua_bench_run, refua_bench_compare, refua_bench_gate, refua_bench_baseline (optional): benchmark and regression-gate workflows.
  • refua_regulatory_bundle, refua_regulatory_verify, refua_regulatory_summary, refua_regulatory_checklist (optional): regulatory evidence bundle operations.
  • refua_deploy_plan, refua_deploy_render (optional): deployment planning and artifact rendering.

All major tools expose strict JSON schemas, including discriminated entity unions by type and typed output schemas.

Output-format notes:

  • structure_output_format: canonical values are cif or bcif; mmcif is accepted as a compatibility alias for cif.
  • feature_output_format: use torch or npz when writing feature files. If json is provided with a file output request, the server normalizes it to npz and reports a warning.
  • If feature_output_path ends with .json, the server normalizes it to .npz for feature file export.
  • Fold/design responses include a warnings list when compatibility normalization is applied.

Input-compatibility notes:

  • For compatibility with some MCP clients, entities, constraints, antibody, and context_entities also accept JSON-encoded strings and will be normalized server-side.

Execution-policy notes:

  • refua_fold and refua_antibody_design block exploratory names by default (for example sanity_*, *_probe, schema_*, smoke_*) to avoid costly preflight runs.
  • If an exploratory run is intentionally needed, set allow_exploratory_run=true.
  • Asynchronous fold/affinity/design tools accept queue_timeout_seconds (optional).

Error-contract notes:

  • Tool errors return a structured payload with error.code, error.message, optional error.hint, and error.retryable.

Resources And Templates

  • refua://capabilities (resource): runtime feature flags, protocol revision, transport/security config summary.
  • refua://recipes/index (resource): lists canonical recipe names.
  • refua://recipes/{recipe_name} (resource template): returns concrete tool/args examples.
  • refua://protein-properties/index (resource): lists available protein property names/groups.
  • refua://protein-properties/group/{group_name} (resource template): lists property names in a group.
  • refua://protein-properties/property/{property_name} (resource template): property metadata.

Completion support:

  • refua://recipes/{recipe_name} completions for recipe names.
  • refua://protein-properties/group/{group_name} completions for group names.
  • refua://protein-properties/property/{property_name} completions for property names.

Recipe names:

  • fold_protein_ligand
  • affinity_only
  • antibody_design
  • protein_properties
  • clinical_simulation (optional; available when refua-clinical is installed)
  • preclinical_plan (optional; available when refua-preclinical is installed)
  • preclinical_workup (optional; available when refua-preclinical is installed)
  • preclinical_cmc_plan (optional; available when refua-preclinical is installed)
  • preclinical_cmc_release (optional; available when refua-preclinical is installed)
  • data_validate_sources (optional; available when refua-data is installed)
  • wetlab_protocol_run (optional; available when refua-wetlab is installed)
  • bench_init (optional; available when refua-bench is installed)
  • regulatory_verify (optional; available when refua-regulatory is installed)
  • deploy_plan (optional; available when refua-deploy is installed)

Workflow

Recommended call sequence:

  1. Read refua://recipes/index and optionally a recipe template.
  2. Read refua://capabilities for runtime support and limits.
  3. For sequence-only property analysis, call refua_protein_properties.
  4. Call refua_validate_spec to catch schema/logic issues before expensive runs (deep_validate=true for asset-backed construction checks).
  5. Execute refua_fold, refua_affinity, refua_antibody_design, refua_clinical_simulator (optional), refua_wetlab_* (optional), or the refua_preclinical_* tools (optional).
  6. For long runs, set async_mode=true and poll refua_job.

Examples

Fold protein + ligand with optional affinity:

{
  "tool": "refua_fold",
  "args": {
    "name": "protein_ligand",
    "entities": [
      {"type": "protein", "id": "A", "sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ"},
      {"type": "ligand", "id": "lig", "smiles": "CCO"}
    ],
    "constraints": [
      {"type": "pocket", "binder": "lig", "contacts": [["A", 5], ["A", 8]]}
    ],
    "affinity": {"binder": "lig"},
    "admet": true
  }
}

Affinity-only:

{
  "tool": "refua_affinity",
  "args": {
    "name": "protein_ligand_affinity",
    "entities": [
      {"type": "protein", "id": "A", "sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ"},
      {"type": "ligand", "id": "lig", "smiles": "CCO"}
    ],
    "binder": "lig"
  }
}

Antibody-focused design:

{
  "tool": "refua_antibody_design",
  "args": {
    "name": "ab_design",
    "antibody": {
      "type": "antibody",
      "ids": ["H", "L"],
      "heavy_cdr_lengths": [12, 10, 14],
      "light_cdr_lengths": [10, 9, 9]
    },
    "context_entities": [
      {"type": "protein", "id": "A", "sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ"}
    ]
  }
}

Validate only (no run):

{
  "tool": "refua_validate_spec",
  "args": {
    "action": "fold",
    "entities": [
      {"type": "protein", "id": "A", "sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ"},
      {"type": "ligand", "id": "lig", "smiles": "CCO"}
    ]
  }
}

ADMET predictions:

{
  "tool": "refua_admet_profile",
  "args": {
    "smiles": "CCO",
    "include_scoring": true
  }
}

Protein properties:

{
  "tool": "refua_protein_properties",
  "args": {
    "sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ",
    "groups": ["basic"],
    "include_catalog": true
  }
}

Clinical simulation (optional):

{
  "tool": "refua_clinical_simulator",
  "args": {
    "trial_id": "small_molecule_phase2",
    "replicates": 80,
    "include_workup": true,
    "include_replicates": false
  }
}

Preclinical workup (optional):

{
  "tool": "refua_preclinical_workup",
  "args": {
    "seed": 7,
    "lloq_ng_ml": 1.0,
    "use_template_rows_when_missing": true,
    "include_references": true
  }
}

Preclinical CMC release assessment (optional):

{
  "tool": "refua_preclinical_release_assess",
  "args": {
    "batch_results": {
      "assay_percent": 99.0,
      "content_uniformity_av": 9.8,
      "dissolution_q30_percent": 92.0,
      "total_impurities_percent": 0.7,
      "water_content_percent": 1.5,
      "appearance_score": 5.0
    },
    "include_references": true
  }
}

Note: DNA/RNA entities are supported for Boltz2 folding only (BoltzGen does not accept DNA/RNA entities).

Long-Running Jobs

For runs that exceed the tool-call timeout, set async_mode=true and poll sparingly (for example every 30-120 seconds) or follow recommended_poll_seconds from refua_job.

{
  "tool": "refua_fold",
  "args": {
    "async_mode": true,
    "entities": [...]
  }
}

Then poll:

{
  "tool": "refua_job",
  "args": {
    "job_id": "..."
  }
}

For queued/running jobs, the response includes recommended_poll_seconds plus queue and estimate metadata (queue_position, queue_depth, average_runtime_seconds, estimated_start_seconds, estimated_remaining_seconds). Set include_result=true once complete to fetch results. Set cancel=true in refua_job to cancel queued/running jobs.

Long-poll support:

{
  "tool": "refua_job",
  "args": {
    "job_id": "...",
    "wait_for_terminal_seconds": 300,
    "cancel": false,
    "include_result": true
  }
}

Experimental MCP Tasks

This server enables MCP experimental task support (tasks/get, tasks/result, tasks/list, tasks/cancel) and advertises task execution support for refua_validate_spec, refua_fold, refua_affinity, refua_antibody_design, and refua_admet_profile. refua_clinical_simulator and refua_preclinical_templates / refua_preclinical_plan / refua_preclinical_schedule / refua_preclinical_bioanalysis / refua_preclinical_workup / refua_preclinical_cmc_templates / refua_preclinical_cmc_plan / refua_preclinical_batch_record / refua_preclinical_stability_plan / refua_preclinical_stability_assess / refua_preclinical_release_assess are also task-enabled when installed.

If your client supports task-augmented tool calls, prefer tasks for long-running operations. Task cancellation (tasks/cancel) is wired to background job cancellation. Otherwise, continue with async_mode=true + refua_job.

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

refua_mcp-0.8.0.tar.gz (61.0 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

refua_mcp-0.8.0-py3-none-any.whl (47.7 kB view details)

Uploaded Python 3

File details

Details for the file refua_mcp-0.8.0.tar.gz.

File metadata

  • Download URL: refua_mcp-0.8.0.tar.gz
  • Upload date:
  • Size: 61.0 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: poetry/2.4.0 CPython/3.14.4 Darwin/25.4.0

File hashes

Hashes for refua_mcp-0.8.0.tar.gz
Algorithm Hash digest
SHA256 9126ae13d3d8154e1a67b4f489860c005d0f5dc2c25c7fb3d4e0392d9a9f6960
MD5 c61b9251fa0d2c4351d71824f6fd390d
BLAKE2b-256 aee6b026c2bb841ed97dcc4547933e0df7990e84139babf03c793bc16da5f739

See more details on using hashes here.

File details

Details for the file refua_mcp-0.8.0-py3-none-any.whl.

File metadata

  • Download URL: refua_mcp-0.8.0-py3-none-any.whl
  • Upload date:
  • Size: 47.7 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: poetry/2.4.0 CPython/3.14.4 Darwin/25.4.0

File hashes

Hashes for refua_mcp-0.8.0-py3-none-any.whl
Algorithm Hash digest
SHA256 301ac8d29b59b26b5b6b981d49befecca224fdbb4ad14fc288b86095bb3027a8
MD5 ff13b106a04d7651dc6d1b2e91601873
BLAKE2b-256 4e5f1986babb7b82e80bf85f6cadd69cc88fbb9c316ab18a284ab88c63ac26db

See more details on using hashes here.

Release history Release notifications | RSS feed

This release

0.8.0 This release

2 files

0.7.1

2 files

0.7.0

2 files

0.6.0

2 files

0.5.2

2 files

0.5.1

2 files

0.5.0

2 files

0.4.0

2 files

0.3.0

2 files

0.2.1

2 files

0.2.0

2 files

0.1.0

2 files

0.0.1

2 files

Anthropic, PBC Visionary sponsor Bloomberg Visionary sponsor Hudson River Trading Visionary sponsor Meta Visionary sponsor NVIDIA Visionary sponsor Microsoft Sustainability sponsor Depot Continuous Integration AWS Cloud computing and Security Sponsor Datadog Monitoring Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page