Jupyter UI extensions for drug discovery visualization - ADMET, 3D complex viewer, SMILES drawing
Project description
refua-notebook
Jupyter UI extensions for drug discovery visualization. This package provides inline notebook widgets for displaying ADMET properties, 3D molecular structures, and SMILES drawings from Refua objects. It also includes an IPython extension that automatically registers rich HTML representations for Refua objects.
Features
- IPython Extension: Automatic widget display for Refua
SM,Protein,Complex, andFoldResultobjects - Rich Visualization: 2D structures, 3D Mol* views, and property summaries rendered directly from Refua objects
Installation
pip install refua-notebook
Or with Poetry:
poetry add refua-notebook
refua-notebook depends on Refua directly, so installing this package will also
install refua.
Quick Start
Automatic Widget Display (IPython Extension)
The easiest way to use refua-notebook is to load it as an IPython extension. This automatically registers rich HTML representations for Refua objects:
# Option 1: Load as IPython extension
%load_ext refua_notebook
# Option 2: Activate programmatically
import refua_notebook
refua_notebook.activate()
# Now Refua objects display automatically as widgets!
from refua import SM, Protein, Complex
# Proteins show sequence info (and 3D structure if folded)
Protein("MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ", ids="A")
# Folded complexes show a tabbed view with 3D structure, affinity, and molecule details
complex = Complex([
Protein("MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ", ids="A"),
SM("CCO"),
]).request_affinity()
result = complex.fold()
complex # Shows 3D structure with binding affinity (uses complex.last_fold)
Displaying the Refua objects directly is enough; the extension handles rich HTML rendering automatically.
JupyterLab Renderer (Required for JupyterLab)
JupyterLab blocks inline scripts, so the package ships a prebuilt JupyterLab
renderer that loads Mol* and SmilesDrawer locally and renders the
application/vnd.refua+json MIME output. With recent JupyterLab versions, no
jupyter labextension install or jupyter lab build step is required—installing
the Python package is enough.
To rebuild the prebuilt labextension (requires network access for npm packages):
cd labextension
yarn install
yarn build:prod
Refua Integration
refua-notebook is built on top of the Refua
drug discovery toolkit:
from refua import Complex, Protein, SM
# Fold a protein-ligand complex
complex = Complex([
Protein("MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ", ids="A"),
SM("CCO"),
]).request_affinity()
result = complex.fold()
# Display the Refua objects directly
complex
result.affinity
Examples
The examples/ directory includes runnable notebooks:
refua_folding.ipynbrefua_antibody_design.ipynb
Rebuild all examples (executes and writes outputs in-place):
poetry run jupyter nbconvert --execute --to notebook --inplace examples/*.ipynb
API Reference
Extension Functions
# Load extension (in notebook)
%load_ext refua_notebook
# Programmatic activation
import refua_notebook
refua_notebook.activate() # Enable automatic widget display
refua_notebook.deactivate() # Disable automatic widget display
refua_notebook.is_active() # Check if extension is active
Development
# Clone the repository
git clone <your-repo-url>
cd refua-notebook
# Install dependencies
poetry install
# Run tests
poetry run pytest
# Optional browser-level JupyterLab widget test
poetry run playwright install chromium
REFUA_JLAB_PLAYWRIGHT=1 poetry run pytest tests/test_jupyterlab_playwright.py
# Format code
poetry run black refua_notebook tests
License
MIT License
Project details
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file refua_notebook-0.5.0.tar.gz.
File metadata
- Download URL: refua_notebook-0.5.0.tar.gz
- Upload date:
- Size: 2.2 MB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: poetry/2.3.2 CPython/3.14.2 Darwin/25.2.0
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
e33c718fa8757da8d953c39e255c2386a82c6ba5c863d5438f9d6c4772bdbf1e
|
|
| MD5 |
4b73ecc0f6fa604f7118320f0bf387f1
|
|
| BLAKE2b-256 |
dfd737f91ff47096ab93b3d81d7350c6ea7c369d8ff138b0a0e64d9d0aaabccc
|
File details
Details for the file refua_notebook-0.5.0-py3-none-any.whl.
File metadata
- Download URL: refua_notebook-0.5.0-py3-none-any.whl
- Upload date:
- Size: 1.6 MB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: poetry/2.3.2 CPython/3.14.2 Darwin/25.2.0
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
509fb28651894e12264216ef503e5582950a0e7397b9cb5902f1cd20c10254d3
|
|
| MD5 |
0259a4b16276cf7ab6c4663a4ce39a5b
|
|
| BLAKE2b-256 |
e44fdfa52c552c7da65d914646849c982f1605313679891fb0180f0df442f16f
|