Skip to main content

Antibody numbering software

Project description

RIOT - Rapid Immunoglobulin Overview Tool

Have some raw antibody sequences? Find matching germlines, perform numbering and get results in a familiar AIRR format!

RIOT supports both nucleotide and amino acid sequences as well as all major schemes: KABAT, CHOTHIA, MARTIN and IMGT.

MOTIVATION

Antibodies are a cornerstone of the immune system, playing a pivotal role in identifying and neutralizing infections caused by bacteria, viruses, and other pathogens. Understanding their structure, function, can provide insights into both the body's natural defenses and the principles behind many therapeutic interventions, including vaccines and antibody-based drugs. The analysis and annotation of antibody sequences, including the identification of variable, diversity, joining, and constant genes, as well as the delineation of framework regions and complementarity determining regions, are essential for understanding their structure and function. Currently analyzing large volumes of antibody sequences for is routine in antibody discovery, requiring fast and accurate tools. While there are existing tools designed for the annotation and numbering of antibody sequences, they often have limitations such as being restricted to either nucleotide or amino acid sequences, reliance on non-uniform germline databases, or slow execution times. Here we present Rapid Immunoglobulin Overview Tool (RIOT), a novel open source solution for antibody numbering that addresses these shortcomings. RIOT handles nucleotide and amino acid sequence processing, comes with a free germline database, and is computationally efficient. We hope the tool will facilitate rapid annotation of antibody sequencing outputs for the benefit of understanding of antibody biology and discovering novel therapeutics.

Links:

Requirements

  • Python ^3.10
  • C compiler (reason: scikit-bio)

Quickstart

> pip install riot-na

> riot_na -s GGGCGTTTTGGCAC...

{
    "sequence_header": "-",
    "sequence": "GGGCGTTTTGGCAC...",
    "numbering_scheme": "imgt",
    "locus": "igh",
    "stop_codon": False,
    "vj_in_frame": True,
    "v_frameshift": False,
    "j_frameshift": False,
    "productive": True,
    "rev_comp": False,
    "complete_vdj": True,
    "v_call": "IGHV1-69*01",
    "d_call": "IGHD3-3*01",
    "j_call": "IGHJ6*02",
    "c_call": "IGHM",
    "v_frame": 0,
    ...
}

Installation

Riot is distributed in prebuild binary wheels for all major platforms. Just run in your chosen virtualenv:

pip install riot-na

Usage

CLI

Usage: riot_na [OPTIONS]

Options:
  -f, --input-file PATH           Path to input FASTA file.
  -s, --sequence TEXT             Input sequence.
  -o, --output-file PATH          Path to output CSV file. If not specified,
                                  stdout is used.
  --scheme [KABAT|CHOTHIA|IMGT|MARTIN]
                                  Which numbering scheme should be used: IMGT,
                                  KABAT, CHOTHIA, MARTIN. Default IMGT
  --species [HOMO_SAPIENS|MUS_MUSCULUS|CUSTOM]
                                  Which species germline sequences should be
                                  used. Default is all species.
  --input-type [NT|AA]            What kind of sequences are provided on
                                  input. Default is nucleotide sequences.
  -p, --ncpu INTEGER              Number of parallel processes to use. Default
                                  is number of physical cores.
  -e, --extend_alignment BOOLEAN  Include unaligned beginning of the query
                                  sequence in numbering.This option impacts
                                  only amino acid sequences passed with -s option.
  --multiple-domains BOOLEAN      Return all domains of multiple domain
                                  proteins.
  --help                          Show this message and exit.

Examples:

Run on single sequence and print output to stdout:

riot_na -s <sequence>

Run on single sequence and save output to csv:

riot_na -s <sequence> -o result.csv

Run on fasta file:

riot_na -f input.fasta -o results.csv

API Nucleotides

from riot_na import create_riot_nt, Organism, Scheme, RiotNumberingNT, AirrRearrangementEntryNT

riot_nt: RiotNumberingNT = create_riot_nt(allowed_species = [Organism.HOMO_SAPIENS])
airr_result: AirrRearrangementEntryNT = riot_nt.run_on_sequence(
                    header = "SRR13857054.957936",
                    query_sequence = "GAACCAAACTGACTGTCCTAGGCCAGCCCAAGTCTTCGCCATCAGTCACCCTGTTTCCACCTTCCCCTGAAGAGCTAAAAAAA",
                    scheme = Scheme.KABAT
                )

API Amino Acids

from riot_na import create_riot_aa, Organism, Scheme, RiotNumberingAA, AirrRearrangementEntryAA

riot_aa: RiotNumberingAA = create_riot_aa(allowed_species = [Organism.HOMO_SAPIENS])
airr_result: AirrRearrangementEntryAA = riot_aa.run_on_sequence(
                    header = "SRR13385915.5101835",
                    query_sequence = "QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPGDTATYYCARRGGTIFGVVIILVRRPPL",
                    scheme = Scheme.KABAT,
                    extend_alignment = True
                )

Caching

We provide two cached wrappers for create_riot_nt() and crate_riot_aa() functions - get_or_create_riot_nt() | get_or_create_riot_aa(). They can be used exactly the same way as base functions:

from riot_na import get_or_create_riot_aa, Organism, Scheme, RiotNumberingAA, AirrRearrangementEntryAA

riot_aa: RiotNumberingAA = get_or_create_riot_aa(allowed_species = [Organism.HOMO_SAPIENS])
airr_result: AirrRearrangementEntryAA = riot_aa.run_on_sequence(
                    header = "SRR13385915.5101835",
                    query_sequence = "QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPGDTATYYCARRGGTIFGVVIILVRRPPL",
                    scheme = Scheme.KABAT,
                    extend_alignment = True
                )

Multiprocessing

Riot uses precompiled Rust module for prefiltering. This means the RiotNumberingNT/AA objects are unpickable, so you cannot pass it as a worker's parameter in eg. mp.Pool() or use it in Spark's UDF functions. This is achievable by using cached wrappers we provide get_or_create_riot_nt() | get_or_create_riot_aa(). Below you can find working and not working examples.

The following will not work:

import functools
import multiprocessing as mp
from riot_na import create_riot_aa, AirrRearrangementEntryAA, RiotNumberingAA

seqs = ["EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGGSFYYYYMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTGHHHHHHHHG"] * 10

def worker(riot: RiotNumberingAA, seq: str) -> AirrRearrangementEntryAA:
    airr = riot.run_on_sequence("-", seq)
    return airr

riot = create_riot_aa()

worker_partial = functools.partial(worker, riot)

with mp.Pool() as pool:
    res = pool.map(worker_partial, seqs)

# Output: TypeError: cannot pickle 'builtins.Prefiltering' object

The proper way:

import multiprocessing as mp
from riot_na import get_or_create_riot_aa, AirrRearrangementEntryAA

seqs = ["EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGGSFYYYYMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTGHHHHHHHHG"] * 10


def worker(seq: str) -> AirrRearrangementEntryAA:
    riot = get_or_create_riot_aa()
    airr = riot.run_on_sequence("-", seq)
    return airr

with mp.Pool() as pool:
    res = pool.map(worker, seqs)

Spark UDF example:

import json
from pyspark.sql import SparkSession
from pyspark.sql.functions import udf
from cachetools import cached
from riot_na import get_or_create_riot_aa, RiotNumberingAA

spark = SparkSession.builder.appName("Riot on Spark").getOrCreate()

seq = "EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGGSFYYYYMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTGHHHHHHHHG"

df = spark.createDataFrame([{"seq":  seq}]*10)

@udf
def number_sequence(seq: str)-> str:
    riot = get_or_create_riot_aa()
    airr = riot.run_on_sequence("-", seq)
    return json.dumps(airr.__dict__)

df.select(number_sequence("seq")).collect()

For a pure Python solution (without the use of cachetools package) you can check riot_na/api/api_mp.py file.

Multidomains support

RIOT's multidomains support allows detection and numbering of multiple immunoglobulin domains within a single protein sequence, such as therapeutic antibodies containing both heavy chain (VH) and light chain (VL) domains. When enabled with the --multiple-domains flag (or return_all_domains=True in the API), RIOT returns separate numbering results for each detected domain rather than just the best single match. The system automatically identifies domain boundaries, truncates sequences at the beginning of each V gene segment, and provides additional metadata including the original query sequence and segment start/end positions for each domain. This is particularly useful for analyzing therapeutic constructs like bispecific antibodies, CAR-T constructs, or other multi-domain fusion proteins where each immunoglobulin domain needs independent numbering and analysis.

Germline database

RIOT uses OGRDB as a primary source of germline alleles. Database version as of 22.01.2024 was used. C genes are imported from igblast FTP site fhttps://ftp.ncbi.nih.gov/blast/executables/igblast/release/database/ncbi_human_c_genes.tar

Data format

This section describes the fields of numbering result object AirrRearrangementEntry(AA). It is based on AIRR Rearrangement Schema format extended by 7 columns highlighted in the table (bold) and emptied of the unnecessary ones. There are also some differences in fields’ definitions, so the AIRR format specification should be treated only as a loose reference. Description of the original AIRR format can be found here.

Attributes:

  1. All fields in the format are required (always present)
  2. All fields are nullable, with the exception of sequence_header and sequence

AirrRearrangementNT fields definitions

Name Type Definition
sequence_header string Fasta header for given input sequence (when numbering a FASTA file) or value of sequence_header parameter (when using RiotNumberingNT API).
sequence string The segment nucleotide sequence. May be truncated to the beginning of v_gene when --multiple-domains flag is enabled
sequence_aa string Translated query sequence.
numbering_scheme enum ["imgt", "kabat", "chothia", "martin"] Used numbering scheme, default is "imgt".
locus string Gene locus (chain type).
locus_species string Binomial designation of the species from which the locus originates.
stop_codon boolean True if the aligned sequence contains a stop codon.
vj_in_frame boolean True if the V and J gene alignments are in-frame. In details: distance between v_alignement reading frame and j_alignment reading frame is divisible by 3.
v_frameshift boolean True if the V gene in the query nucleotide sequence contains a translational frameshift relative to the frame of the V gene reference sequence. In other words: sum of insertions and deletions between consecutive matches in alignment is divisible by 3.
j_frameshift boolean True if the J gene in the query nucleotide sequence contains a translational frameshift relative to the frame of the J gene reference sequence. In other words: sum of insertions and deletions between consecutive matches in alignment is divisible by 3.
productive boolean True if the V(D)J sequence is predicted to be productive. In details: stop_codon is False and vj_in_frame is True
rev_comp boolean True if the alignment is on the opposite strand (reverse complemented) with respect to the query sequence. If True, indicates the sequence field contains a reverse complemented original query sequence.
complete_vdj boolean True if the sequence alignment spans the entire V(D)J region. Meaning, sequence_alignment includes both the first V gene codon that encodes the mature polypeptide chain (i.e., after the leader sequence) and the last complete codon of the J gene (i.e., before the J-C splice site). This does not require an absence of deletions within the internal FWR and CDR regions of the alignment.
v_call string V gene with allele.
d_call string D gene with allele.
j_call string J gene with allele.
c_call string Constant region gene with allele.
v_frame enum [0, 1, 2] V frame offset from v_alignment_start.
j_frame enum [0, 1, 2] J frame offset from j_alignment_start.
sequence_alignment string Gapped alignment of query sequence spanning V-J segment aligned to germline, reverse complemented if needed.
germline_alignment string Gapped aligned germline sequence spanning the same region as the sequence_alignment field (V(D)J region). Segments between matched germlines are gapped to match query sequence length.
sequence_alignment_aa string Amino acid translation of the sequence_alignment.
germline_alignment_aa string Amino acid translation of the germline_alignment.
v_alignment_start integer Start position of the V gene alignment in sequence_alignment (1-based closed interval).
v_alignment_end integer End position of the V gene alignment in sequence_alignment (1-based closed interval).
d_alignment_start integer Start position of the D gene alignment in sequence_alignment (1-based closed interval).
d_alignment_end integer End position of the D gene alignment in sequence_alignment (1-based closed interval).
j_alignment_start integer Start position of the J gene alignment in sequence_alignment (1-based closed interval).
j_alignment_end integer End position of the J gene alignment in sequence_alignment (1-based closed interval).
v_sequence_alignment string Aligned portion of query sequence assigned to the V gene.
v_sequence_alignment_aa string Amino acid translation of the v_sequence_alignment field.
v_germline_alignment string Aligned V gene germline sequence.
v_germline_alignment_aa string Aligned amino acid V gene germline sequence.
d_sequence_alignment string Aligned portion of query sequence assigned to the D gene.
d_germline_alignment string Aligned D gene germline sequence.
j_sequence_alignment string Aligned portion of query sequence assigned to the J gene.
j_sequence_alignment_aa string Amino acid translation of the j_sequence_alignment field.
j_germline_alignment string Aligned J gene germline sequence.
j_germline_alignment_aa string Aligned amino acid J gene germline sequence.
c_sequence_alignment string Aligned portion of query sequence assigned to the constant region.
c_germline_alignment string Aligned constant region germline sequence.
fwr1 string Nucleotide sequence of the aligned FWR1 region.
fwr1_aa string Amino acid translation of the fwr1 field.
cdr1 string Nucleotide sequence of the aligned CDR1 region.
cdr1_aa string Amino acid translation of the cdr1 field.
fwr2 string Nucleotide sequence of the aligned FWR2 region.
fwr2_aa string Amino acid translation of the fwr2 field.
cdr2 string Nucleotide sequence of the aligned CDR2 region.
cdr2_aa string Amino acid translation of the cdr2 field.
fwr3 string Nucleotide sequence of the aligned FWR3 region.
fwr3_aa string Amino acid translation of the fwr3 field.
cdr3 string Nucleotide sequence of the aligned CDR3 region.
cdr3_aa string Amino acid translation of the cdr3 field.
fwr4 string Nucleotide sequence of the aligned FWR4 region.
fwr4_aa string Amino acid translation of the fwr4 field.
junction string Junction region nucleotide sequence, where the junction is defined as the CDR3 plus the two flanking conserved codons.
junction_aa string Amino acid translation of the junction.
junction_length integer Number of nucleotides in the junction sequence.
junction_aa_length integer Number of amino acids in the junction sequence.
v_score number Alignment score (Smith-Waterman) for the V gene.
d_score number Alignment score (Smith-Waterman) for the D gene alignment.
j_score number Alignment score (Smith-Waterman) for the J gene alignment.
c_score number Alignment score (Smith-Waterman) for the C gene alignment.
v_cigar string CIGAR string for the V gene alignment.
d_cigar string CIGAR string for the D gene alignment.
j_cigar string CIGAR string for the J gene alignment.
c_cigar string CIGAR string for the C gene alignment.
v_support number V gene alignment E-value. Note: Every value less than 1.4e-45 will appear as 0.0 (due to single-precision floating point standard limitation)
d_support number D gene alignment E-value. Note: Every value less than 1.4e-45 will appear as 0.0 (due to single-precision floating point standard limitation)
j_support number J gene alignment E-value. Note: Every value less than 1.4e-45 will appear as 0.0 (due to single-precision floating point standard limitation)
c_support number C gene alignment E-value. Note: Every value less than 1.4e-45 will appear as 0.0 (due to single-precision floating point standard limitation)
v_identity number Fractional identity for the V gene alignment.
d_identity number Fractional identity for the D gene alignment.
j_identity number Fractional identity for the J gene alignment.
c_identity number Fractional identity for the C gene alignment.
v_sequence_start integer Start position of the V gene in the query sequence (1-based closed interval).
v_sequence_end integer End position of the V gene in the query sequence (1-based closed interval).
d_sequence_start integer Start position of the D gene in the query sequence (1-based closed interval).
d_sequence_end integer End position of the D gene in the query sequence (1-based closed interval).
j_sequence_start integer Start position of the J gene in the query sequence (1-based closed interval).
j_sequence_end integer End position of the J gene in the query sequence (1-based closed interval).
c_sequence_start integer Start position of the C gene in the query sequence (1-based closed interval).
c_sequence_end integer End position of the C gene in the query sequence (1-based closed interval).
v_germline_start integer Alignment start position in the V gene reference sequence (1-based closed interval).
v_germline_end integer Alignment end position in the V gene reference sequence (1-based closed interval).
d_germline_start integer Alignment start position in the D gene reference sequence (1-based closed interval).
d_germline_end integer Alignment end position in the D gene reference sequence (1-based closed interval).
j_germline_start integer Alignment start position in the J gene reference sequence (1-based closed interval).
j_germline_end integer Alignment end position in the J gene reference sequence (1-based closed interval).
c_germline_start integer Alignment start position in the C gene reference sequence (1-based closed interval).
c_germline_end integer Alignment end position in the C gene reference sequence (1-based closed interval).
fwr1_start integer FWR1 start position in the query sequence (1-based closed interval).
fwr1_end integer FWR1 end position in the query sequence (1-based closed interval).
cdr1_start integer CDR1 start position in the query sequence (1-based closed interval).
cdr1_end integer CDR1 end position in the query sequence (1-based closed interval).
fwr2_start integer FWR2 start position in the query sequence (1-based closed interval).
fwr2_end integer FWR2 end position in the query sequence (1-based closed interval).
cdr2_start integer CDR2 start position in the query sequence (1-based closed interval).
cdr2_end integer CDR2 end position in the query sequence (1-based closed interval).
fwr3_start integer FWR3 start position in the query sequence (1-based closed interval).
fwr3_end integer FWR3 end position in the query sequence (1-based closed interval).
cdr3_start integer CDR3 start position in the query sequence (1-based closed interval).
cdr3_end integer CDR3 end position in the query sequence (1-based closed interval).
fwr4_start integer FWR4 start position in the query sequence (1-based closed interval).
fwr4_end integer FWR4 end position in the query sequence (1-based closed interval).
sequence_aa_scheme_cigar string CIGAR string defining sequence_aa to scheme alignment.
scheme_residue_mapping json string Scheme numbering of sequence_alignment_aa - positions not present in this sequence are not included.
positional_scheme_mapping json string Mapping from absolute residue position in sequence_alignment_aa (0-based) to corresponding scheme position.
exc string Exception (if any) thrown during ANARCI numbering.
additional_validation_flags json string JSON string containing additional validation flags.
query_sequence string The query sequence. (Optional: only available with --multiple-domains flag enabled)
segment_start integer Start position of the segment in query_sequence (1-based closed interval). (Optional: only available with --multiple-domains flag enabled)
segment_end integer End position of the segment in query_sequence (1-based closed interval). (Optional: only available with --multiple-domains flag enabled)

Additional validation flags

Following table describes additional validation flags calculated alongside main fields. Last 5 flags regarding conserved residues apply only then using IMGT schema.

Field name AIRR fields required for calculation Description
regions_in_aligned_sequence all regions (fwr1, cdr1, fwr2 …); sequence_alignment True if all region sequences, concatenated, are present in sequence_alignment.
regions_aa_in_aligned_sequence_aa all _aa (fwr1_aa, cdr1_aa, …); sequence_alignment_aa True if all region_aa sequences, concatenated, are present in sequence_alignment_aa.
translated_regions_in_aligned_sequence_aa all regions (fwr1, cdr1, fwr2 …); sequence_alignment_aa; v_frame True if all region sequences, concatenated and translated using v_frame, are present in sequence_alignment_aa.
correct_vj_in_frame v_alignment_start; v_frame; j_alignment_start; j_frame True if vj_in_frame is equal to: distance between v_alignement translation frame and j_alignment translation frame is divisible by 3.
cdr3_in_junction cdr3; junction; cdr3_aa; junction_aa True if cdr3 is present in junction and cdr3_aa is present in junction_aa.
locus_as_in_v_gene locus; v_call True if locus is consistent with the one specified in V gene (v_call).
v_gene_alignment sequence; v_sequence_start; v_sequence_end; v_sequence_alignment True if v_sequence_alignment is equal to substring in sequence from position v_sequence_start to v_sequence_end.
j_gene_alignment sequence; j_sequence_start; j_sequence_end; j_sequence_alignment True if j_sequence_alignment is equal to substring in sequence from position j_sequence_start to j_sequence_end.
c_gene_alignment sequence; c_sequence_start; c_sequence_end; c_sequence_alignment True if c_sequence_alignment is equal to substring in sequence from position c_sequence_start to c_sequence_end.
no_negative_offsets_inside_v_alignment fwr1_start; fwr1_end; cdr1_start; cdr1_end; fwr2_start; fwr2_end; cdr2_start; cdr2_end; fwr3_start; fwr3_end; cdr3_start True if there is no negative (missing) offset inside V alignment, eg.: fwr1_start == 1; fwr1_end == 35; cdr1_start == -1; cdr1_end == 65.
no_negative_offsets_inside_j_alignment cdr3_end; fwr4_start; fwr4_end True if there is no negative (missing) offset inside J alignment, eg.: cdr3_end == 293; fwr4_start == -1; fwr4_end == 326.
consecutive_offsets all _start and _end True if consecutive region_start and region_end offsets are ascendant, and no region_start is greater than corresponding region_end.
no_empty_cdr3 cdr3 True if cdr3 is present.
primary_sequence_in_sequence_alignment_aa sequence_alignment_aa; scheme_residue_mapping True if concatenation of scheme_residue_mapping amino acids results in a sequence that is a part of sequence_alignment_aa and amino acids are in correct order.
no_insertion_next_to_deletion_aa sequence_aa_scheme_cigar True if there are no insertions next to deletions - indicates correct CIGARs merging process.
insertions_in_correct_places scheme_residue_mapping; numbering_scheme; locus True if insertions are on schema-allowed positions.
correct_fwr1_offsets sequence; v_sequence_start; fwr1_start; fwr1_end; fwr1 True if fwr1 is equal to substring in sequence cut from position fwr1_start up to fwr1_end. If fwr1_start is -1 (missing), v_sequence_start is used as a starting offset instead.
correct_cdr1_offsets sequence; cdr1_start; cdr1_end; cdr1 True if cdr1 is equal to substring in sequence cut from position cdr1_start up to cdr1_end.
correct_fwr2_offsets sequence; fwr2_start; fwr2_end; fwr2 True if fwr2 is equal to substring in sequence cut from position fwr2_start up to fwr2_end.
correct_cdr2_offsets sequence; cdr2_start; cdr2_end; cdr2 True if cdr2 is equal to substring in sequence cut from position cdr2_start up to cdr2_end.
correct_fwr3_offsets sequence; fwr3_start; fwr3_end; fwr3 True if fwr3 is equal to substring in sequence cut from position fwr3_start up to fwr3_end.
correct_cdr3_offsets sequence; cdr3_start; cdr3_end; cdr3 True if cdr3 is equal to substring in sequence cut from position cdr3_start up to cdr3_end.
correct_fwr4_offsets sequence; j_sequence_end; fwr4_start; fwr4_end; fwr4 True if fwr4 is equal to substring in sequence cut from position fwr4_start up to fwr4_end. If fwr4_end is -1 (missing), j_sequence_end is used as an ending offset instead.
no_empty_fwr1_in_v v_sequence_alignment; fwr1 True if fwr1 is present.
no_empty_cdr1_in_v v_sequence_alignment; cdr1 True if cdr1 is present.
no_empty_fwr2_in_v v_sequence_alignment; fwr2 True if fwr2 is present.
no_empty_cdr2_in_v v_sequence_alignment; cdr2 True if cdr2 is present.
no_empty_fwr3_in_v v_sequence_alignment; fwr3 True if fwr3 is present.
no_empty_fwr4_in_j j_sequence_alignment; fwr4 True if fwr4 is present.
conserved_C23_present imgt_residue_mapping True if conserved Cysteine on IMGT position 23 is present.
conserved_W41_present imgt_residue_mapping True if conserved Tryptophan on IMGT position 41 is present.
conserved_C104_present imgt_residue_mapping True if conserved Cysteine on IMGT position 104 is present.
conserved_W118_heavy_present imgt_residue_mapping True if conserved Tryptophan on IMGT position 118 is present (heavy chain only).
conserved_F118_light_present imgt_residue_mapping True if conserved Phenylalanine on IMGT position 118 is present (light chain only).

AirrRearrangementAA field definitions

Airr data format was developed for nucleotide sequences. For the amino acid pipeline a similar to format was created. Most fields are analogous to nucleotide-based one, with _aa suffix in name.

Name Type Definition
sequence_header string Fasta header for given input sequence (when numbering a FASTA file) or value of sequence_header parameter (when using RiotNumberingNT API).
sequence_aa string The query sequence. May be truncated by the detection of v_gene based segment when --multiple-domains flag is enabled.
numbering_scheme enum ["imgt", "kabat", "chothia", "martin"] Used numbering scheme, default is "imgt".
locus string Gene locus (chain type).
locus_species string Binomial designation of the species from which the locus originates.
stop_codon boolean True if the aligned sequence contains a stop codon.
productive boolean True if the V(D)J sequence is predicted to be productive. In details: stop_codon is False and V and J genes are detected.
complete_vdj boolean True if the sequence alignment spans the entire V(D)J region. Meaning, sequence alignment includes both the first V amino acid and the last of the J gene (i.e., before the J-C splice site). This does not require an absence of deletions within the internal FWR and CDR regions of the alignment.
v_call string V gene with allele.
j_call string J gene with allele.
germline_alignment_aa string Assembled, aligned, full-length inferred germline sequence spanning the same region as the sequence_alignment_aa field (V-J region).
sequence_alignment_aa string Segment of query sequence spanning V-J aligned to germline.
v_alignment_start_aa integer Start position of the V gene alignment in sequence_alignment_aa (1-based closed interval).
v_alignment_end_aa integer End position of the V gene alignment in sequence_alignment_aa (1-based closed interval).
j_alignment_start_aa integer Start position of the J gene alignment in sequence_alignment_aa (1-based closed interval).
j_alignment_end_aa integer End position of the J gene alignment in sequence_alignment_aa (1-based closed interval).
v_sequence_alignment_aa string Aligned portion of query sequence assigned to the V gene.
v_germline_alignment_aa string Aligned V gene germline sequence.
j_sequence_alignment_aa string Aligned portion of query sequence assigned to the J gene.
j_germline_alignment_aa string Aligned J gene germline sequence.
fwr1_aa string Amino acid sequence of the aligned FWR1 region.
cdr1_aa string Amino acid sequence of the aligned CDR1 region.
fwr2_aa string Amino acid sequence of the aligned FWR2 region.
cdr2_aa string Amino acid sequence of the aligned CDR2 region.
fwr3_aa string Amino acid sequence of the aligned FWR3 region.
cdr3_aa string Amino acid sequence of the aligned CDR3 region.
fwr4_aa string Amino acid sequence of the aligned FWR4 region.
junction_aa string Junction region nucleotide sequence, where the junction is defined as the CDR3 plus the two flanking conserved amino acids.
junction_aa_length integer Number of amino acids in the junction sequence.
v_score_aa number Alignment score (Smith-Waterman) for the V gene.
j_score_aa number Alignment score (Smith-Waterman) for the J gene alignment.
v_cigar_aa string CIGAR string for the V gene alignment.
j_cigar_aa string CIGAR string for the J gene alignment.
v_support_aa number V gene alignment E-value. Note: Every value less than 1.4e-45 will appear as 0.0 (due to single-precision floating point standard limitation)
j_support_aa number J gene alignment E-value. Note: Every value less than 1.4e-45 will appear as 0.0 (due to single-precision floating point standard limitation)
v_identity_aa number Fractional identity for the V gene alignment.
j_identity_aa number Fractional identity for the J gene alignment.
v_sequence_start_aa integer Start position of the V gene in the query sequence (1-based closed interval).
v_sequence_end_aa integer End position of the V gene in the query sequence (1-based closed interval).
j_sequence_start_aa integer Start position of the J gene in the query sequence (1-based closed interval).
j_sequence_end_aa integer End position of the J gene in the query sequence (1-based closed interval).
v_germline_start_aa integer Alignment start position in the V gene reference sequence (1-based closed interval).
v_germline_end_aa integer Alignment end position in the V gene reference sequence (1-based closed interval).
j_germline_start_aa integer Alignment start position in the J gene reference sequence (1-based closed interval).
j_germline_end_aa integer Alignment end position in the J gene reference sequence (1-based closed interval).
fwr1_start_aa integer FWR1 start position in the query sequence (1-based closed interval).
fwr1_end_aa integer FWR1 end position in the query sequence (1-based closed interval).
cdr1_start_aa integer CDR1 start position in the query sequence (1-based closed interval).
cdr1_end_aa integer CDR1 end position in the query sequence (1-based closed interval).
fwr2_start_aa integer FWR2 start position in the query sequence (1-based closed interval).
fwr2_end_aa integer FWR2 end position in the query sequence (1-based closed interval).
cdr2_start_aa integer CDR2 start position in the query sequence (1-based closed interval).
cdr2_end_aa integer CDR2 end position in the query sequence (1-based closed interval).
fwr3_start_aa integer FWR3 start position in the query sequence (1-based closed interval).
fwr3_end_aa integer FWR3 end position in the query sequence (1-based closed interval).
cdr3_start_aa integer CDR3 start position in the query sequence (1-based closed interval).
cdr3_end_aa integer CDR3 end position in the query sequence (1-based closed interval).
fwr4_start_aa integer FWR4 start position in the query sequence (1-based closed interval).
fwr4_end_aa integer FWR4 end position in the query sequence (1-based closed interval).
sequence_aa_scheme_cigar string CIGAR string defining sequence_alignment_aa to scheme alignment.
scheme_residue_mapping json string Scheme numbering of sequence_alignment_aa - positions not present in this sequence are not included.
positional_scheme_mapping json string Mapping from absolute residue position in sequence_alignment_aa (0-based) to corresponding scheme position.
exc string Exception (if any) thrown during ANARCI numbering.
additional_validation_flags json string JSON string containing additional validation flags.
query_sequence string The query sequence. (Optional: only available with --multiple-domains flag enabled)
segment_start integer Start position of the segment in query_sequence (1-based closed interval). (Optional: only available with --multiple-domains flag enabled)
segment_end integer End position of the segment in query_sequence (1-based closed interval). (Optional: only available with --multiple-domains flag enabled)

Additional validation flags (AA)

Following table describes additional validation flags calculated alongside main fields. Last 5 flags regarding conserved residues apply only then using IMGT schema.

AIRR fields required for calculation Description
regions_aa_in_aligned_sequence_aa all _aa (fwr1_aa_aa, cdr1_aa_aa, …); sequence_alignment_aa True if all region_aa sequences, concatenated, are present in sequence_alignment_aa.
locus_as_in_v_gene locus; v_call True if locus is consistent with the one specified in V gene (v_call).
v_gene_alignment_aa sequence; v_sequence_start_aa; v_sequence_end_aa; v_sequence_alignment_aa True if v_sequence_alignment_aa is equal to substring in sequence from position v_sequence_start_aa to v_sequence_end_aa.
j_gene_alignment_aa sequence; j_sequence_start_aa; j_sequence_end_aa; j_sequence_alignment_aa True if j_sequence_alignment_aa is equal to substring in sequence from position j_sequence_start_aa to j_sequence_end_aa.
no_negative_offsets_inside_v_alignment_aa fwr1_aa_start_aa; fwr1_aa_end_aa; cdr1_aa_start_aa; cdr1_aa_end_aa; fwr2_aa_start_aa; fwr2_aa_end_aa; cdr2_aa_start_aa; cdr2_aa_end_aa; fwr3_aa_start_aa; fwr3_aa_end_aa; cdr3_aa_start_aa True if there is no negative (missing) offset inside V alignment, eg.: fwr1_aa_start_aa == 1; fwr1_aa_end_aa == 26; cdr1_aa_start_aa == -1; cdr1_aa_end_aa == 38.
no_negative_offsets_inside_j_alignment_aa cdr3_aa_end_aa; fwr4_aa_start_aa; fwr4_aa_end_aa True if there is no negative (missing) offset inside J alignment, eg.: cdr3_aa_end_aa == 117; fwr4_aa_start_aa == -1; fwr4_aa_end_aa == 128.
consecutive_offsets_aa all _start_aa and _end_aa True if consecutive region_start_aa and region_end_aa offsets are ascendant, and no region_start_aa is greater than corresponding region_end_aa.
no_empty_cdr3_aa cdr3_aa True if cdr3_aa is present.
primary_sequence_in_sequence_alignment_aa sequence_alignment_aa; scheme_residue_mapping True if concatenation of scheme_residue_mapping amino acids results in a sequence that is a part of sequence_alignment_aa and amino acids are in correct order.
no_insertion_next_to_deletion_aa sequence_aa_scheme_cigar True if there are no insertions next to deletions - indicates correct CIGARs merging process.
insertions_in_correct_places scheme_residue_mapping; numbering_scheme; locus True if insertions are on schema-allowed positions.
correct_fwr1_aa_offsets sequence; v_sequence_start_aa; fwr1_aa_start_aa; fwr1_aa_end_aa; fwr1_aa True if fwr1_aa is equal to substring in sequence cut from position fwr1_aa_start_aa up to fwr1_aa_end_aa. If fwr1_aa_start_aa is -1 (missing), v_sequence_start_aa is used as a starting offset instead.
correct_cdr1_aa_offsets sequence; cdr1_aa_start_aa; cdr1_aa_end_aa; cdr1_aa True if cdr1_aa is equal to substring in sequence cut from position cdr1_aa_start_aa up to cdr1_aa_end_aa.
correct_fwr2_aa_offsets sequence; fwr2_aa_start_aa; fwr2_aa_end_aa; fwr2_aa True if fwr2_aa is equal to substring in sequence cut from position fwr2_aa_start_aa up to fwr2_aa_end_aa.
correct_cdr2_aa_offsets sequence; cdr2_aa_start_aa; cdr2_aa_end_aa; cdr2_aa True if cdr2_aa is equal to substring in sequence cut from position cdr2_aa_start_aa up to cdr2_aa_end_aa.
correct_fwr3_aa_offsets sequence; fwr3_aa_start_aa; fwr3_aa_end_aa; fwr3_aa True if fwr3_aa is equal to substring in sequence cut from position fwr3_aa_start_aa up to fwr3_aa_end_aa.
correct_cdr3_aa_offsets sequence; cdr3_aa_start_aa; cdr3_aa_end_aa; cdr3_aa True if cdr3_aa is equal to substring in sequence cut from position cdr3_aa_start_aa up to cdr3_aa_end_aa.
correct_fwr4_aa_offsets sequence; j_sequence_end_aa; fwr4_aa_start_aa; fwr4_aa_end_aa; fwr4_aa True if fwr4_aa is equal to substring in sequence cut from position fwr4_aa_start_aa up to fwr4_aa_end_aa. If fwr4_aa_end_aa is -1 (missing), j_sequence_end_aa is used as an ending offset instead.
no_empty_fwr1_aa_in_v v_sequence_alignment_aa; fwr1_aa True if fwr1_aa is present.
no_empty_cdr1_aa_in_v v_sequence_alignment_aa; cdr1_aa True if cdr1_aa is present.
no_empty_fwr2_aa_in_v v_sequence_alignment_aa; fwr2_aa True if fwr2_aa is present.
no_empty_cdr2_aa_in_v v_sequence_alignment_aa; cdr2_aa True if cdr2_aa is present.
no_empty_fwr3_aa_in_v v_sequence_alignment_aa; fwr3_aa True if fwr3_aa is present.
no_empty_fwr4_aa_in_j j_sequence_alignment_aa; fwr4_aa True if fwr4_aa is present.
conserved_C23_present scheme_residue_mapping True if conserved Cysteine on IMGT position 23 is present.
conserved_W41_present scheme_residue_mapping True if conserved Tryptophan on IMGT position 41 is present.
conserved_C104_present scheme_residue_mapping True if conserved Cysteine on IMGT position 104 is present.
conserved_W118_heavy_present scheme_residue_mapping True if conserved Tryptophan on IMGT position 118 is present (heavy chain only).
conserved_F118_light_present scheme_residue_mapping True if conserved Phenylalanine on IMGT position 118 is present (light chain only).

Examples

Sample usage of the software is presented at https://colab.research.google.com/drive/1xKO4udsX5gmnY88eDKWsQaUnHsLuFwVA?usp=sharing. To give users the ability to use RIOT with a custom database, we provide google colab script which showcases how to build a custom germline database for RIOT. It is available at https://colab.research.google.com/drive/1VCStUKgZ1ggi2Xf5YV7hFWHxxzP29BjK?usp=sharing.

Development

RIOT uses prefiltering module written in Rust, which requires some extra steps to install from source.

# Install Poetry

curl -sSL https://install.python-poetry.org | python3 - --version 1.7.1

# Add `export PATH="/root/.local/bin:$PATH"` to your shell configuration file.****

# Download and run the Rust installation script
curl --proto '=https' --tlsv1.2 -sSf https://sh.rustup.rs | sh -s -- -y

# Restart shell to reload PATH

# Verify the installation
!poetry --version
!rustc --version
!cargo --version

git clone https://github.com/NaturalAntibody/riot_na
cd riot_na

poetry install
poetry run maturin develop -r
poetry install

Citing this work

The code and data in this package is based on the following paper <we release the paper once it clears peer review>. If you use it, please cite:

@misc{riot,
      title={RIOT - Rapid Immunoglobulin Overview Tool - rapid annotation of nucleotide and amino acid immunoglobulin sequences using an open germline database.},
      author={Paweł Dudzic, Bartosz Janusz, Tadeusz Satława, Dawid Chomicz, Tomasz Gawłowski, Rafał Grabowski, Przemysław Jóźwiak, Mateusz Tarkowski, Maciej Mycielski, Sonia Wróbel, Konrad Krawczyk*},

}

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

riot_na-4.0.4.tar.gz (551.5 kB view details)

Uploaded Source

Built Distributions

If you're not sure about the file name format, learn more about wheel file names.

riot_na-4.0.4-pp311-pypy311_pp73-manylinux_2_17_x86_64.manylinux2014_x86_64.whl (6.8 MB view details)

Uploaded PyPymanylinux: glibc 2.17+ x86-64

riot_na-4.0.4-pp311-pypy311_pp73-manylinux_2_17_aarch64.manylinux2014_aarch64.whl (5.3 MB view details)

Uploaded PyPymanylinux: glibc 2.17+ ARM64

riot_na-4.0.4-cp313-cp313-win_amd64.whl (509.9 kB view details)

Uploaded CPython 3.13Windows x86-64

riot_na-4.0.4-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl (6.8 MB view details)

Uploaded CPython 3.13manylinux: glibc 2.17+ x86-64

riot_na-4.0.4-cp313-cp313-manylinux_2_17_aarch64.manylinux2014_aarch64.whl (5.4 MB view details)

Uploaded CPython 3.13manylinux: glibc 2.17+ ARM64

riot_na-4.0.4-cp313-cp313-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl (936.0 kB view details)

Uploaded CPython 3.13macOS 10.12+ universal2 (ARM64, x86-64)macOS 10.12+ x86-64macOS 11.0+ ARM64

riot_na-4.0.4-cp312-cp312-win_amd64.whl (509.9 kB view details)

Uploaded CPython 3.12Windows x86-64

riot_na-4.0.4-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl (6.8 MB view details)

Uploaded CPython 3.12manylinux: glibc 2.17+ x86-64

riot_na-4.0.4-cp312-cp312-manylinux_2_17_aarch64.manylinux2014_aarch64.whl (5.4 MB view details)

Uploaded CPython 3.12manylinux: glibc 2.17+ ARM64

riot_na-4.0.4-cp312-cp312-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl (936.1 kB view details)

Uploaded CPython 3.12macOS 10.12+ universal2 (ARM64, x86-64)macOS 10.12+ x86-64macOS 11.0+ ARM64

riot_na-4.0.4-cp311-cp311-win_amd64.whl (509.5 kB view details)

Uploaded CPython 3.11Windows x86-64

riot_na-4.0.4-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl (6.8 MB view details)

Uploaded CPython 3.11manylinux: glibc 2.17+ x86-64

riot_na-4.0.4-cp311-cp311-manylinux_2_17_aarch64.manylinux2014_aarch64.whl (5.3 MB view details)

Uploaded CPython 3.11manylinux: glibc 2.17+ ARM64

riot_na-4.0.4-cp311-cp311-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl (936.4 kB view details)

Uploaded CPython 3.11macOS 10.12+ universal2 (ARM64, x86-64)macOS 10.12+ x86-64macOS 11.0+ ARM64

riot_na-4.0.4-cp310-cp310-win_amd64.whl (509.6 kB view details)

Uploaded CPython 3.10Windows x86-64

riot_na-4.0.4-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl (6.8 MB view details)

Uploaded CPython 3.10manylinux: glibc 2.17+ x86-64

riot_na-4.0.4-cp310-cp310-manylinux_2_17_aarch64.manylinux2014_aarch64.whl (5.3 MB view details)

Uploaded CPython 3.10manylinux: glibc 2.17+ ARM64

riot_na-4.0.4-cp310-cp310-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl (936.4 kB view details)

Uploaded CPython 3.10macOS 10.12+ universal2 (ARM64, x86-64)macOS 10.12+ x86-64macOS 11.0+ ARM64

File details

Details for the file riot_na-4.0.4.tar.gz.

File metadata

  • Download URL: riot_na-4.0.4.tar.gz
  • Upload date:
  • Size: 551.5 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.13.7

File hashes

Hashes for riot_na-4.0.4.tar.gz
Algorithm Hash digest
SHA256 ad98b877d1a0113c45f542ef896e16a2ae1c3893657f31e125bba0728261375d
MD5 6a8ace052f7101d2cd00a0af2c2ef9f1
BLAKE2b-256 a2b2c13ef233e2454a7bbf6725706d53d73bfa4b277514b5daab0e05b96d10b6

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4.tar.gz:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-pp311-pypy311_pp73-manylinux_2_17_x86_64.manylinux2014_x86_64.whl.

File metadata

File hashes

Hashes for riot_na-4.0.4-pp311-pypy311_pp73-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
Algorithm Hash digest
SHA256 183ed5752f3120b6a64d9454804a45496da20eb392215ebfc32dc7532073224b
MD5 426b93ae2f04bc6d519e03d5b1b014de
BLAKE2b-256 00e83cfd2f867fd8ce01b91c44439ab64c1f342ac06e8241ebe575680c0988d0

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-pp311-pypy311_pp73-manylinux_2_17_x86_64.manylinux2014_x86_64.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-pp311-pypy311_pp73-manylinux_2_17_aarch64.manylinux2014_aarch64.whl.

File metadata

File hashes

Hashes for riot_na-4.0.4-pp311-pypy311_pp73-manylinux_2_17_aarch64.manylinux2014_aarch64.whl
Algorithm Hash digest
SHA256 5fca281989e4c10ae88bb6bd333be9d68540b722f9995b337f7b93a9648b2456
MD5 b591c616b555aab9abae55a26d1c9be1
BLAKE2b-256 e0d4c1c6c328aba1b72cb1c01d9c69e8b472f36a80442c86533652d67b2c5aac

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-pp311-pypy311_pp73-manylinux_2_17_aarch64.manylinux2014_aarch64.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp313-cp313-win_amd64.whl.

File metadata

  • Download URL: riot_na-4.0.4-cp313-cp313-win_amd64.whl
  • Upload date:
  • Size: 509.9 kB
  • Tags: CPython 3.13, Windows x86-64
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.13.7

File hashes

Hashes for riot_na-4.0.4-cp313-cp313-win_amd64.whl
Algorithm Hash digest
SHA256 f457c79ffb0d5e32e5df3ffaa7872225a0d8e52462cd07857aed772831b47104
MD5 e2418cc42a32b5a6b59080085e4dcc9e
BLAKE2b-256 f960b32d82449dc288a537aee731ac4d9b8c2302f1933d0c054bf362d10b82c0

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp313-cp313-win_amd64.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl.

File metadata

File hashes

Hashes for riot_na-4.0.4-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
Algorithm Hash digest
SHA256 c45d3e3c762b8b717e6183a65d8f3c24a02f7395ebaaee4aa74b0c33c22177e0
MD5 2e2e75126060bcb44c53c460e95e903c
BLAKE2b-256 d609706a63076f58f00e197b5e6365f3f3a66335e4e6ebfed9c8ce16ca1daf4c

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp313-cp313-manylinux_2_17_aarch64.manylinux2014_aarch64.whl.

File metadata

File hashes

Hashes for riot_na-4.0.4-cp313-cp313-manylinux_2_17_aarch64.manylinux2014_aarch64.whl
Algorithm Hash digest
SHA256 24f23b4217f43a72bf91d1cbffdab6b6f221ff21a9dbe42a816f0baf500fc047
MD5 4c59feba50b2e060fc64603b30c38cea
BLAKE2b-256 60cef86063941fad9388eaf856831ab165a5f64ec481115d2cbbb20c238f3973

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp313-cp313-manylinux_2_17_aarch64.manylinux2014_aarch64.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp313-cp313-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl.

File metadata

File hashes

Hashes for riot_na-4.0.4-cp313-cp313-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl
Algorithm Hash digest
SHA256 eda2e933c1bb48b68d2b4fcef1130c1326d0d47add54028bdc67c106d8e2c19f
MD5 901de9d49922d149b9f56f04b5a0c4a7
BLAKE2b-256 763f95e1a17832d4782daa720ac63c1a492b2f31c5d7acdf2ef3aa3e17296fcc

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp313-cp313-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp312-cp312-win_amd64.whl.

File metadata

  • Download URL: riot_na-4.0.4-cp312-cp312-win_amd64.whl
  • Upload date:
  • Size: 509.9 kB
  • Tags: CPython 3.12, Windows x86-64
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.13.7

File hashes

Hashes for riot_na-4.0.4-cp312-cp312-win_amd64.whl
Algorithm Hash digest
SHA256 67fd612940d036fc30bafe832bf4cb8b312d96f1ab1e573d23f62a349ac536bc
MD5 1fde8b8c4f84bb9e7ee066034af7072a
BLAKE2b-256 51a1fdcded8ea3a8a6f20ef52ad5b0da5efc08b22fbe6f268bda3d98acdd6d6e

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp312-cp312-win_amd64.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl.

File metadata

File hashes

Hashes for riot_na-4.0.4-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
Algorithm Hash digest
SHA256 b543f943b911951f4d796c54696e892268453f71234b9966703214b600c62610
MD5 f075ef10b16b1fbae5ae9d191814d3c5
BLAKE2b-256 ccc23af63a56b4682167675477cd6c643f9e78acef90f6a0f2fd515215988c9b

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp312-cp312-manylinux_2_17_aarch64.manylinux2014_aarch64.whl.

File metadata

File hashes

Hashes for riot_na-4.0.4-cp312-cp312-manylinux_2_17_aarch64.manylinux2014_aarch64.whl
Algorithm Hash digest
SHA256 ce0d0b0b279bc39ea796aa4152fdce407fcd280eb852fde915f178ecef291e99
MD5 bfca5bf8c776048a832f755dbac45228
BLAKE2b-256 1f56dfac7c8c1ee6f5adaa2248bacd222564c2f8b109b47989f7dec24a34c188

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp312-cp312-manylinux_2_17_aarch64.manylinux2014_aarch64.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp312-cp312-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl.

File metadata

File hashes

Hashes for riot_na-4.0.4-cp312-cp312-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl
Algorithm Hash digest
SHA256 40e391117ef434618eb75fab182986067097d51bd9dde42ec03e1f4b1596cff6
MD5 b87d2012324fd61c107cafcc760365a4
BLAKE2b-256 0da88e61dd0f7e314fd469b6c445265c24a62cea4a349d9e3d522e2013be6dd2

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp312-cp312-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp311-cp311-win_amd64.whl.

File metadata

  • Download URL: riot_na-4.0.4-cp311-cp311-win_amd64.whl
  • Upload date:
  • Size: 509.5 kB
  • Tags: CPython 3.11, Windows x86-64
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.13.7

File hashes

Hashes for riot_na-4.0.4-cp311-cp311-win_amd64.whl
Algorithm Hash digest
SHA256 2a38ceeb2413cf49892b206f373b4abb7548dddc4e847876eabf57629183d815
MD5 5bd6e8348018b3f31797f39b79ac1582
BLAKE2b-256 e1dd0a6ef28c672a2e4027a81c476f42ea1c68d8e1b6a7febbbb140a83ea35a4

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp311-cp311-win_amd64.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl.

File metadata

File hashes

Hashes for riot_na-4.0.4-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
Algorithm Hash digest
SHA256 d60dc2c10be9e72a407f6e587b176e74532806b59b6577c4eba44fa1622ebaf2
MD5 6ff5c2f3e44ba3d83ec1418e76104b9b
BLAKE2b-256 3a0dcc434cb0010541d80c5eeeee0210ad967ac36c9b4959b7f9776fe1926571

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp311-cp311-manylinux_2_17_aarch64.manylinux2014_aarch64.whl.

File metadata

File hashes

Hashes for riot_na-4.0.4-cp311-cp311-manylinux_2_17_aarch64.manylinux2014_aarch64.whl
Algorithm Hash digest
SHA256 d73bc64b68250b518b0bef4aa3d9aac9506dc588c1cfb2e064326c4ad963d88e
MD5 b20c127d88b7400d644ca34d82aaca62
BLAKE2b-256 5bf92f49cc5ddc39213044722ca67b37d579ccaf22d3f49aba254c748e28e08f

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp311-cp311-manylinux_2_17_aarch64.manylinux2014_aarch64.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp311-cp311-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl.

File metadata

File hashes

Hashes for riot_na-4.0.4-cp311-cp311-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl
Algorithm Hash digest
SHA256 99bc10bb82fb7161a8361dd56a6fa57a2a76cf9ab738afda0717e708bc8932ae
MD5 fc26c0333bfad891e1a5c3e68b85efe4
BLAKE2b-256 2094c145df6945e67f3b5190d5d40a0b865b5552da9a1b625adbb1624d85f9b3

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp311-cp311-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp310-cp310-win_amd64.whl.

File metadata

  • Download URL: riot_na-4.0.4-cp310-cp310-win_amd64.whl
  • Upload date:
  • Size: 509.6 kB
  • Tags: CPython 3.10, Windows x86-64
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.13.7

File hashes

Hashes for riot_na-4.0.4-cp310-cp310-win_amd64.whl
Algorithm Hash digest
SHA256 85287313fc1d452c283db9a8e3a4a346f18867c69a218875a6ee9af9ac115d00
MD5 b72e1da1b0aa385379200725d1f31777
BLAKE2b-256 4abc89bade54b382412f8708680d83a1076f0f0c9935b6be2694b01316f057c9

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp310-cp310-win_amd64.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl.

File metadata

File hashes

Hashes for riot_na-4.0.4-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
Algorithm Hash digest
SHA256 07970825fa7220294fff6648930f053fdb43f996c47d6a379ec651592a4b64d5
MD5 feb20dd316f2139732e9b1b3ae038844
BLAKE2b-256 8a62333405047510ab2982e35605aa50e1b1301d6c91eab897dfb4206417dd73

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp310-cp310-manylinux_2_17_aarch64.manylinux2014_aarch64.whl.

File metadata

File hashes

Hashes for riot_na-4.0.4-cp310-cp310-manylinux_2_17_aarch64.manylinux2014_aarch64.whl
Algorithm Hash digest
SHA256 c132b907f677761e847757536b739f0c3354427c622d43b2743f787ab22d3f3b
MD5 102ddf203622b5ea4cb9659600811ebe
BLAKE2b-256 0a53a8641cf3e17066b713a319eaa54ec53b282a538eb15981faa6253f5c90be

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp310-cp310-manylinux_2_17_aarch64.manylinux2014_aarch64.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file riot_na-4.0.4-cp310-cp310-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl.

File metadata

File hashes

Hashes for riot_na-4.0.4-cp310-cp310-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl
Algorithm Hash digest
SHA256 47f15ee43efeab72da31278b638355ba1011a774f526f0bdcd9817cb725411e1
MD5 80d0a0f4672ea4119ccecdc629ee6326
BLAKE2b-256 7487991cf9fcab4a23050b68c195e25b041214230717f422f37810c49253f7ff

See more details on using hashes here.

Provenance

The following attestation bundles were made for riot_na-4.0.4-cp310-cp310-macosx_10_12_x86_64.macosx_11_0_arm64.macosx_10_12_universal2.whl:

Publisher: master-test-build-upload.yml on NaturalAntibody/riot_na

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page