Skip to main content

Simple MSA

Project description

MSA by ML researchers for ML researchers --️ in pytorch/cuda ❤️
pip install sseqs
wget https://foldify.org/uniref_bfd_mgy_cf.xbit 
from sseqs import msa
msa("HPETLVKVKDAEDQLGARVGYIELDLNSGKILE", "msa.a3m")

No need for $5h/h server with 1000GB RAM. Developed for $0.3/h rtx4090+128GB RAM.

limitations

  • no protein pairing
  • sequence length < 1000 (working on 2048)
  • 128gb RAM (working on 64GB w/ compression)
  • server.py supporting Boltz2 MSA-server (adding soon)
  • no <16GB approximate version (yet)
  • no evals (working on runs'n'poses + antibody)

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

sseqs-0.0.6.tar.gz (34.3 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

sseqs-0.0.6-py3-none-any.whl (36.8 kB view details)

Uploaded Python 3

File details

Details for the file sseqs-0.0.6.tar.gz.

File metadata

  • Download URL: sseqs-0.0.6.tar.gz
  • Upload date:
  • Size: 34.3 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/6.2.0 CPython/3.11.0

File hashes

Hashes for sseqs-0.0.6.tar.gz
Algorithm Hash digest
SHA256 53f8b21ac1373036de67503406b3dfd757d8c9619fd694fc8d86e384b8d057d8
MD5 e9d14d1dbb0cbeea59bc4e63d721c64d
BLAKE2b-256 b5aaeb7d2222d2fccf9118cb1e5714aaaa9adab0b37b8b89deed21f4cbc308f3

See more details on using hashes here.

File details

Details for the file sseqs-0.0.6-py3-none-any.whl.

File metadata

  • Download URL: sseqs-0.0.6-py3-none-any.whl
  • Upload date:
  • Size: 36.8 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/6.2.0 CPython/3.11.0

File hashes

Hashes for sseqs-0.0.6-py3-none-any.whl
Algorithm Hash digest
SHA256 61e9cb16c16a5a56789e6ba1890e09d41ebbf45f366b012125d01e885e2edd79
MD5 69ba503fb5c42125c240a282eba3173f
BLAKE2b-256 d8976bc71727306c59d5f005acda841213651299a9eae4ecfcd8309c786037b4

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page