Predicting enzyme catalytic optimum temperature with ML
Project description
TOMER: Temperature Optima for Enzymes with Resampling
TOMER is a Python package for predicting the catalytic optimum temperature (Topt) of enzymes with machine learning. TOMER was trained with a bagging ensemble on a dataset of 2,917 proteins. To prevent large error on the prediction of higher temperature values, resampling strategies were applied to mitigate the effects of the imbalanced distribution of the dataset. Code for design of TOMER can be found here.
Citation
If you find TOMER useful, please cite:
Gado, J.E., Beckham, G.T., and Payne, C.M (2020). Improving enzyme optimum temperature prediction with resampling strategies and ensemble learning. J. Chem. Inf. Model. 60(8), 4098-4107.
Installation
Install with pip
pip install tomer
Or from source (preferred).
git clone https://github.com/jafetgado/tomer.git
cd tomer
pip install -r requirements.txt
python setup.py install
Prerequisites
(version used in this work)
Python 3 (3.6.6)
scikit-learn (0.21.2)
numpy (1.19.5)
pandas (0.24.1)
Usage
There are two main functions in TOMER for predicting the enzyme optimum temperature: pred_seq_topt, which predicts optimum temperature of a single protein sequence (in string format), and pred_fasta_topt, which predicts the optimum temperatures of protein sequences in a fasta file. To use these functions, you need to specify the optimal growth temperature (OGT) of the source organism of the protein. If the OGT is not known, a prediction may be obtained using TOME.
Examples
import tomer
# Predict optimum temperature of a single sequence.
sequence = '''MKKQVVEVLVEGGKATPGPPLGPAIGPLGLNVKQVVDKINEATKEFAGMQVPVKIIV
DPVTKQFEIEVGVPPTSQLIKKELGLEKGSGEPKHNIVGNLTMEQVIKIAKMKRSQML
ALTLKAAAKEVIGTALSMGVTVEGKDPRIVQREIDEGVYDELFEKAEKE'''
ogt = 95
y_pred, y_err = tomer.pred_seq_topt(sequence, ogt)
print(y_pred) # predicted optimum temperature
84.4
print(y_err) # Standard error of prediction (from 100 base learners in ensemble)
1.929
# Predict optimum temperatures of sequences in fasta file
fasta_file = 'test/sequences.fasta'
ogt_file = 'test/ogts.txt'
df = tomer.pred_fasta_topt(fasta_file, ogt_file) # returns Pandas dataframe
print(df)
ID Topt Std err
0 P43408 79.345 1.53561
1 Q97X08 81.705 0.442442
2 F8A9V0 76.37 1.16195
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distributions
Built Distribution
File details
Details for the file tomer-1.0-py3-none-any.whl
.
File metadata
- Download URL: tomer-1.0-py3-none-any.whl
- Upload date:
- Size: 839.1 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.3.0 pkginfo/1.4.2 requests/2.25.1 setuptools/39.1.0 requests-toolbelt/0.9.1 tqdm/4.56.1 CPython/3.6.5
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 |
398e54fcdca5e7d4ed3ad4f9e320fc446bb5fcb3b48a48f408af6cb28d872bae
|
|
MD5 |
07c311856cd2088f8fe1c642652880ca
|
|
BLAKE2b-256 |
0e25c5add678f7feb2f4e885263b112d5062eb9ba9fb96d6859d15d6c8306c82
|