Skip to main content

Apply a consistent format to your tox.toml file with comment support. See the releases for what changed.

Philosophy

This is an opinionated formatter, with the same objectives as black: it offers few configuration settings on purpose. In return you get consistency, predictability, and smaller diffs.

Use

Via CLI

tox-toml-fmt is a CLI tool that needs Python 3.10 or higher to run. Install it into an isolated environment with pipx or uv; that way you can upgrade tox-toml-fmt later without disturbing the rest of your system. A pip path follows for completeness, though we discourage it:

# install uv per https://docs.astral.sh/uv/#getting-started
uv tool install tox-toml-fmt
tox-toml-fmt --help

Via pre-commit hook

See pre-commit/pre-commit for instructions, sample .pre-commit-config.yaml:

- repo: https://github.com/tox-dev/tox-toml-fmt
  rev: "v1.0.0"
  hooks:
    - id: tox-toml-fmt

Via Python

Call tox-toml-fmt as a Python module to format TOML from your own code.

from tox_toml_fmt import run

# Format a tox.toml file and return the exit code
exit_code = run(["path/to/tox.toml"])

The run function accepts command-line arguments as a list and returns an exit code (0 for success, non-zero for failure).

The [tox-toml-fmt] table is used when present in the tox.toml file:

[tox-toml-fmt]

# After how many columns split arrays/dicts into multiple lines and wrap long strings;
# use a trailing comma in arrays to force multiline format instead of lowering this value
column_width = 120

# Number of spaces for indentation
indent = 2

# Extra newlines between sub-tables in the same group (e.g. "\n" for one blank line
# between sub-tables)
sub_table_spacing = ""

# Extra newlines between root table groups (e.g. "\n" for one blank line, "\n\n" for two)
separate_root_table = "\n"

# Environments pinned to the start of env_list
pin_envs = ["fix", "type"]

If not set they will default to values from the CLI. The example above shows the defaults (except pin_envs which defaults to an empty list).

Shared configuration file

Place formatting settings in a standalone tox-toml-fmt.toml file instead of (or alongside) the [tox-toml-fmt] table. In a monorepo this shares one configuration across projects without repeating it in every tox.toml.

The formatter searches for tox-toml-fmt.toml from the directory of the file being formatted up to the filesystem root, and the first match wins. Pass an explicit path via --config:

tox-toml-fmt --config /path/to/tox-toml-fmt.toml tox.toml

The shared config file uses the same keys as the [tox-toml-fmt] table, but without the table header:

column_width = 120
indent = 2
sub_table_spacing = ""
separate_root_table = "\n"
pin_envs = ["fix", "type"]

When both a shared config file and a [tox-toml-fmt] table exist, per-file settings from the [tox-toml-fmt] table take precedence over the shared config file.

Settings are read with the same parser that reads the file, so a value only TOML 1.1 spells does not hide the table they are written in. Every key there has to be one the formatter knows, written as the type its command-line flag takes; anything else is reported against the file and the key, and nothing is formatted.

tox-toml-fmt is an opinionated formatter, much like black is for Python code. It keeps configuration minimal so every tox.toml lands on one standard format. That buys you:

  • less time configuring tools

  • smaller diffs when committing changes

  • code reviews where formatting never comes up

A few options exist (column_width, indent, table_format, sub_table_spacing, separate_root_table), but there are no dozens of toggles.

General Formatting

These rules apply uniformly across the entire tox.toml file.

String Quotes

All strings use double quotes by default. Single quotes are only used when the value contains double quotes:

# Before
[env.test]
description = 'Run tests'
commands = ["echo \"hello\""]

# After
[env.test]
description = "Run tests"
commands = [ 'echo "hello"' ]

Key Quotes

TOML keys are normalized to the simplest valid form. Keys that are valid bare keys (containing only A-Za-z0-9_-) have redundant quotes stripped. Single-quoted (literal) keys that require quoting are converted to double-quoted (basic) strings with proper escaping. This applies to all keys: table headers, key-value pairs, and inline table keys:

# Before
[env.'my env']
"description" = "run tests"
pass_env = [{ "else" = "no" }]

# After
[env."my env"]
description = "run tests"
pass_env = [ { else = "no" } ]

Backslashes and double quotes within literal keys are escaped during conversion.

Array Formatting

Arrays are formatted based on line length, trailing comma presence, and comments. Short arrays stay on one line:

# Before
env_list = ["py312", "py313", "lint"]

# After
env_list = [ "py313", "py312", "lint" ]

Arrays that exceed column_width are expanded and get a trailing comma (shown here with a small column_width to keep the example short):

# Before
[env.test]
deps = ["pytest>=7", "coverage>=7", "tox>=4"]

# After
[env.test]
deps = [
  "coverage>=7",
  "pytest>=7",
  "tox>=4",
]

A trailing comma forces the multiline format, even for an array that would otherwise fit on one line:

# Before
deps = ["pytest>=7",]

# After
deps = [
  "pytest>=7",
]

A comment on an entry also forces the multiline format. Here ["pytest>=7", "coverage>=7"] would fit on one line, but the comment keeps it expanded:

deps = [
  "pytest>=7",   # testing framework
  "coverage>=7",
]

Multiline formatting rules:

An array becomes multiline when any of these conditions are met:

  1. Trailing comma present - A trailing comma signals intent to keep multiline format

  2. Exceeds column width - Arrays longer than column_width are expanded (and get a trailing comma added)

  3. Contains comments - Arrays with inline or leading comments are always multiline

String Wrapping

Strings whose line runs past column_width are wrapped using TOML multiline basic strings with line-ending backslashes (shown here with a small column_width). The line is measured from the start of its key, so a long key can be what pushes a value into wrapping; a key already wider than the column keeps its value on one line:

# Before
[env.test]
description = "run the entire unit test suite with coverage"

# After
[env.test]
description = """\
  run the entire unit test suite with \
  coverage\
  """

Specific keys can be excluded from wrapping using skip_wrap_for_keys. Patterns support wildcards (e.g. *.commands skips wrapping for commands under any table).

Table Formatting

Sub-tables can be formatted in two styles controlled by table_format:

Short format (default, collapsed to dotted keys):

[env.test]
description = "run tests"
sub.value = 1

Long format (expanded to table headers):

# Before
[env.test]
description = "run tests"
sub.value = 1

# After
[env.test]
description = "run tests"
[env.test.sub]
value = 1

Individual tables can override the default using expand_tables and collapse_tables.

Table spacing:

By default, different table groups are separated by a blank line, while sub-tables within the same group are kept compact. You can control this with sub_table_spacing and separate_root_table. Each option takes a string of \n characters where each \n adds one blank line. For example, setting sub_table_spacing = "\n" adds a blank line between sub-tables within the same environment.

Environment tables are always expanded:

Regardless of the table_format setting, [env.*] tables are never collapsed into dotted keys under [env]. Each environment always gets its own [env.NAME] table section:

# This is always the output format, even in short mode:
[env.fix]
description = "fix"

[env.test]
description = "test"

# Dotted keys under [env] are automatically expanded:
# [env]
# fix.description = "fix"    →    [env.fix]
#                                  description = "fix"

Sub-tables within an environment (e.g. [env.test.sub]) still follow the table_format setting, and are ordered by the same environment key order as dotted keys: ones the order lists (such as set_env) come first, the rest follow alphabetically.

Comment Preservation

All comments are preserved during formatting:

  • Inline comments - Comments after a value on the same line stay with that value

  • Leading comments - Comments on the line before an entry stay with the entry below

  • Block comments - Multi-line comment blocks are preserved

Inline comment alignment:

Inline comments within arrays are aligned independently per array, based on that array’s longest value:

# Before
deps = [
  "pytest", # testing
  "pytest-cov",  # coverage
  "pytest-mock", # mocking
]

# After
deps = [
  "pytest",      # testing
  "pytest-cov",  # coverage
  "pytest-mock", # mocking
]

Disabled Keys

A commented-out line whose body is itself a single valid key-value (for example # set_env = { A = "1" }) is treated as a temporarily disabled field rather than free text. The formatter enables it for the duration of the pass, so it is laid out and ordered together with the table it belongs to, then comments it out again on the way out. This keeps a disabled key anchored to its entry instead of drifting to the next table, and formats the line the same way the enabled key would be:

# Before
[env_run_base]
description = "run the tests"
# set_env = {A = "1"}

# After
[env_run_base]
description = "run the tests"
# set_env = { A = "1" }

Comments that are not a single valid key-value (prose, multi-line blocks, commented-out table headers like # [env.docs]) are left untouched and follow the usual comment-preservation rules above. The heuristic is purely structural, so a prose comment that happens to be valid TOML is reflowed too; if that matters, phrase the comment so it does not parse as a key-value. Keys that would not fit on a single line within column_width are left as plain comments.

Group Markers

By default the formatter reorders each array and table as a single unit, so any entry can move to its sorted position. Mark a boundary with a standalone comment that starts with # Group:: the formatter then sorts within each group, holds the groups in their original order, and keeps the marker at the top of its group. Reach for this when related entries belong together but should still be sorted.

Files without a # Group: marker format the same as before, so the feature stays opt-in. Case does not matter, so # group: works too. Only standalone comment lines count; the formatter ignores inline trailing comments.

# Before
[env.test]
deps = [
  # Group: runtime
  "requests",
  "click",
  # Group: testing
  "pytest-cov",
  "pytest",
]

# After
[env.test]
deps = [
  # Group: runtime
  "click",
  "requests",
  # Group: testing
  "pytest",
  "pytest-cov",
]

Line Endings

The formatter writes a file back with the line ending it already used, so a \r\n file stays \r\n and Git on Windows does not flag it as modified. A file mixing both endings gets whichever one it uses more, with a tie going to \n. Line endings alone never count as a change, so a file that is already formatted is left alone whichever ending it uses. Output written to stdout always uses \n.

Table-Specific Handling

Beyond general formatting, tables have specific key ordering, value normalization, and sorting rules.

Table Ordering

Tables are reordered into a consistent structure:

  1. Root-level keys (min_version, requires, env_list, etc.)

  2. [env_run_base]

  3. [env_pkg_base]

  4. [env_base.*] sections (shared base configurations)

  5. [env.NAME] sections ordered by env_list if specified

  6. Any remaining [env.*] sections not in env_list, sorted alphabetically

  7. [env] (catch-all environment table, if present)

# env_list determines the order of [env.*] sections
env_list = ["lint", "type", "py312", "py313"]

[env_run_base]
deps = ["pytest>=7"]

[env_pkg_base]
# ...

[env_base.ci]
# shared base config

# Environments appear in env_list order:
[env.lint]
# ...

[env.type]
# ...

[env.py312]
# ...

[env.py313]
# ...

Environments not listed in env_list are placed at the end, sorted alphabetically.

Alias Normalization

Legacy INI-style key names are renamed to their modern tox 4 TOML equivalents. This applies automatically to the root table, [env_run_base], [env_pkg_base], and all [env.*] tables.

Root table aliases:

# Before
envlist = ["py312", "py313"]
minversion = "4.2"
skipsdist = true

# After
min_version = "4.2"
env_list = [ "py313", "py312" ]
no_package = true

Full list: envlistenv_list, toxinidirtox_root, toxworkdirwork_dir, skipsdistno_package, isolated_build_envpackage_env, setupdirpackage_root, minversionmin_version, ignore_basepython_conflictignore_base_python_conflict

Environment table aliases:

# Before
[env_run_base]
basepython = "python3.12"
setenv.PYTHONPATH = "src"
passenv = ["HOME"]

# After
[env_run_base]
base_python = "python3.12"
pass_env = [ "HOME" ]
setenv.PYTHONPATH = "src"

Full list: setenvset_env, passenvpass_env, envdirenv_dir, envtmpdirenv_tmp_dir, envlogdirenv_log_dir, changedirchange_dir, basepythonbase_python, usedevelopuse_develop, sitepackagessystem_site_packages, alwayscopyalways_copy

Root Key Ordering

Keys in the root table are reordered into a consistent sequence:

min_versionrequiresprovision_tox_envenv_listlabelsbasepackage_envpackage_rootno_packageskip_missing_interpretersignore_base_python_conflictwork_dirtemp_dirtox_root

# Before
env_list = ["py312", "lint"]
requires = ["tox>=4.2"]
min_version = "4.2"

# After
min_version = "4.2"
requires = [ "tox>=4.2" ]
env_list = [ "py312", "lint" ]

Environment Key Ordering

Keys within [env_run_base], [env_pkg_base], and [env.*] tables are reordered to group related settings:

factorsrunnerdescriptionbase_pythondefault_base_pythonsystem_site_packagesalways_copydownloadvirtualenv_specpackagepackage_envwheel_build_envpackage_tox_env_typepackage_rootskip_installuse_developmeta_dirpkg_dirpip_preinstall_commandlist_dependencies_commanddepsdependency_groupspylockconstraintsconstrain_package_depsuse_frozen_constraintsextrasrecreaterecreate_commandsparallel_show_outputskip_missing_interpretersfail_fastpass_envdisallow_pass_envset_envchange_dirplatformargs_are_pathsignore_errorscommands_retryignore_outcomeextra_setup_commandscommands_precommandscommands_postallowlist_externalslabelssuicide_timeoutinterrupt_timeoutterminate_timeoutdependsenv_direnv_tmp_direnv_log_dir

The keys of a set_env table keep the order the file gave them: tox reads that table in order, so a key written after file overrides what the file said while one written before it does not.

# Before
[env_run_base]
commands = ["pytest"]
deps = ["pytest>=7"]
description = "run tests"

# After
[env_run_base]
description = "run tests"
deps = [ "pytest>=7" ]
commands = [ "pytest" ]

requires Normalization

Dependencies in the root requires array are normalized per PEP 508 (canonical package names, consistent spacing around specifiers) and sorted alphabetically by package name:

# Before
requires = ["tox >= 4.2", "tox-uv"]

# After
requires = [ "tox>=4.2", "tox-uv" ]

env_list Order

The env_list array is written in a fixed order:

  1. Pinned environments, in the order --pin-env names them

  2. CPython versions (py3.12, py312, 3.12), newest first

  3. PyPy versions (pypy3.10, pypy310), newest first

  4. Everything else (lint, type, docs), by name

A compound name separated by - is placed by the first part of it that reads as one of those.

# Before
env_list = ["lint", "py38", "py312", "docs", "py310-django"]

# After
env_list = [ "py312", "py310-django", "py38", "docs", "lint" ]

An entry that generates environments rather than naming one, such as { product = ... }, names none of them, and what it generates is read where it sits, so it holds the place the file gave it while the names around it move.

That order is also where each [env.NAME] table is written, so the file reads the way tox runs it. --pin-env (here fix,type) moves both:

# Before
env_list = ["lint", "fix", "type"]

[env.lint]
description = "lint"

[env.fix]
description = "fix"

[env.type]
description = "type"

# After
env_list = [ "fix", "type", "lint" ]

[env.fix]
description = "fix"

[env.type]
description = "type"

[env.lint]
description = "lint"

use_develop Upgrade

The legacy use_develop = true setting is automatically converted to the modern package = "editable" equivalent. If use_develop = false, the key is left as-is. tox reads use_develop before package and installs an editable package whatever package says, so a package key already there is given the mode the environment ran with:

# Before
[env_run_base]
use_develop = true

# After
[env_run_base]
package = "editable"

Array Sorting

Certain arrays within environment tables are sorted automatically:

Sorted by canonical PEP 508 package name:

  • deps: dependencies normalized and sorted by package name. constraints names the files tox hands to pip, so it is left as written.

pip reads this list the way it reads a requirements file, where a later --index-url replaces the one before it, so a list holding anything but plain requirements keeps the order it names them in. Pip options and file references (-r, -c, -e, --index-url), local paths (./, ../, /), URLs, artifact filenames (.whl, .zip, .tar.gz and the other archive suffixes pip installs by name), and entries containing tox substitution variables ({tox_root}, etc.) are each such an entry: they are left as written, and the list they sit in is left in its order while every requirement beside them is still normalized:

# Before
[env_run_base]
deps = ["Pytest >= 7", "-r requirements.txt", "coverage", "-e ./my-pkg[test]"]

# After
[env_run_base]
deps = [ "pytest>=7", "-r requirements.txt", "coverage", "-e ./my-pkg[test]" ]

Sorted alphabetically:

  • dependency_groups, allowlist_externals, extras, labels, depends

Special handling for ``pass_env``:

Replacement objects (inline tables like { replace = "default", ... }) are pinned to the start, then string entries are sorted alphabetically:

# Before
[env.test]
pass_env = ["TERM", "CI", { replace = "env", name = "PATH" }, "HOME"]

# After
[env.test]
pass_env = [ { replace = "env", name = "PATH" }, "CI", "HOME", "TERM" ]

Arrays NOT sorted:

  • commands, commands_pre, commands_post: execution order matters

  • base_python: first entry takes priority

Inline Table Key Reordering

Keys within inline tables are reordered into a consistent order based on the inline table’s type. The type is detected by the presence of a discriminator key:

  • replace: replaceconditionofenvkeynamepatternthenelsedefaultextendmarker

  • prefix: prefixstartstop

  • product: productexclude

  • value: valuemarker

Keys not listed in the schema are appended at the end in their original order.

# Before
pass_env = [{ default = ".", replace = "default", extend = true }]
env_list = [{ exclude = ["py312-django"], product = ["py312", "py313"] }]

# After
env_list = [ { product = [ "py312", "py313" ], exclude = [ "py312-django" ] } ]
pass_env = [ { replace = "default", default = ".", extend = true } ]

This reordering applies to all inline tables in the file, including those nested inside arrays.

Other Tables

Any unrecognized tables are preserved and reordered according to standard table ordering rules. Keys within unknown tables are not reordered or normalized.

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

tox_toml_fmt-1.10.1.tar.gz (190.6 kB view details)

Uploaded Source

Built Distributions

If you're not sure about the file name format, learn more about wheel file names.

tox_toml_fmt-1.10.1-pp311-pypy311_pp73-manylinux_2_28_x86_64.whl (1.4 MB view details)

Uploaded PyPymanylinux: glibc 2.28+ x86-64

tox_toml_fmt-1.10.1-pp311-pypy311_pp73-macosx_11_0_arm64.whl (1.2 MB view details)

Uploaded PyPymacOS 11.0+ ARM64

tox_toml_fmt-1.10.1-pp311-pypy311_pp73-macosx_10_12_x86_64.whl (1.3 MB view details)

Uploaded PyPymacOS 10.12+ x86-64

tox_toml_fmt-1.10.1-cp315-cp315t-musllinux_1_2_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.15tmusllinux: musl 1.2+ x86-64

tox_toml_fmt-1.10.1-cp315-cp315t-musllinux_1_2_aarch64.whl (1.3 MB view details)

Uploaded CPython 3.15tmusllinux: musl 1.2+ ARM64

tox_toml_fmt-1.10.1-cp315-cp315t-manylinux_2_28_x86_64.whl (1.4 MB view details)

Uploaded CPython 3.15tmanylinux: glibc 2.28+ x86-64

tox_toml_fmt-1.10.1-cp315-cp315t-manylinux_2_28_aarch64.whl (1.3 MB view details)

Uploaded CPython 3.15tmanylinux: glibc 2.28+ ARM64

tox_toml_fmt-1.10.1-cp315-cp315t-macosx_11_0_arm64.whl (1.2 MB view details)

Uploaded CPython 3.15tmacOS 11.0+ ARM64

tox_toml_fmt-1.10.1-cp315-cp315t-macosx_10_12_x86_64.whl (1.3 MB view details)

Uploaded CPython 3.15tmacOS 10.12+ x86-64

tox_toml_fmt-1.10.1-cp314-cp314t-win_arm64.whl (1.2 MB view details)

Uploaded CPython 3.14tWindows ARM64

tox_toml_fmt-1.10.1-cp314-cp314t-win_amd64.whl (1.2 MB view details)

Uploaded CPython 3.14tWindows x86-64

tox_toml_fmt-1.10.1-cp314-cp314t-musllinux_1_2_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.14tmusllinux: musl 1.2+ x86-64

tox_toml_fmt-1.10.1-cp314-cp314t-musllinux_1_2_aarch64.whl (1.3 MB view details)

Uploaded CPython 3.14tmusllinux: musl 1.2+ ARM64

tox_toml_fmt-1.10.1-cp314-cp314t-manylinux_2_28_x86_64.whl (1.4 MB view details)

Uploaded CPython 3.14tmanylinux: glibc 2.28+ x86-64

tox_toml_fmt-1.10.1-cp314-cp314t-manylinux_2_28_aarch64.whl (1.3 MB view details)

Uploaded CPython 3.14tmanylinux: glibc 2.28+ ARM64

tox_toml_fmt-1.10.1-cp314-cp314t-macosx_11_0_arm64.whl (1.2 MB view details)

Uploaded CPython 3.14tmacOS 11.0+ ARM64

tox_toml_fmt-1.10.1-cp314-cp314t-macosx_10_12_x86_64.whl (1.3 MB view details)

Uploaded CPython 3.14tmacOS 10.12+ x86-64

tox_toml_fmt-1.10.1-cp310-abi3-win_arm64.whl (1.2 MB view details)

Uploaded CPython 3.10+Windows ARM64

tox_toml_fmt-1.10.1-cp310-abi3-win_amd64.whl (1.2 MB view details)

Uploaded CPython 3.10+Windows x86-64

tox_toml_fmt-1.10.1-cp310-abi3-musllinux_1_2_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.10+musllinux: musl 1.2+ x86-64

tox_toml_fmt-1.10.1-cp310-abi3-musllinux_1_2_aarch64.whl (1.3 MB view details)

Uploaded CPython 3.10+musllinux: musl 1.2+ ARM64

tox_toml_fmt-1.10.1-cp310-abi3-manylinux_2_31_riscv64.whl (1.3 MB view details)

Uploaded CPython 3.10+manylinux: glibc 2.31+ riscv64

tox_toml_fmt-1.10.1-cp310-abi3-manylinux_2_28_x86_64.whl (1.4 MB view details)

Uploaded CPython 3.10+manylinux: glibc 2.28+ x86-64

tox_toml_fmt-1.10.1-cp310-abi3-manylinux_2_28_aarch64.whl (1.3 MB view details)

Uploaded CPython 3.10+manylinux: glibc 2.28+ ARM64

tox_toml_fmt-1.10.1-cp310-abi3-macosx_11_0_arm64.whl (1.2 MB view details)

Uploaded CPython 3.10+macOS 11.0+ ARM64

tox_toml_fmt-1.10.1-cp310-abi3-macosx_10_12_x86_64.whl (1.3 MB view details)

Uploaded CPython 3.10+macOS 10.12+ x86-64

File details

Details for the file tox_toml_fmt-1.10.1.tar.gz.

File metadata

  • Download URL: tox_toml_fmt-1.10.1.tar.gz
  • Upload date:
  • Size: 190.6 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/7.0.0 CPython/3.13.14

File hashes

Hashes for tox_toml_fmt-1.10.1.tar.gz
Algorithm Hash digest
SHA256 8cd66ea5d191b5c93029af1d98e9aed17182030399ee25b9b00023058e384e10
MD5 207fe9a2bb40b4dd591d641570421e46
BLAKE2b-256 cea69bd51526c47c6f7f812d14733c1940c5fa6ee74a15d4b066b360268eb66b

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1.tar.gz:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-pp311-pypy311_pp73-manylinux_2_28_x86_64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-pp311-pypy311_pp73-manylinux_2_28_x86_64.whl
Algorithm Hash digest
SHA256 10f044c35f1509b2fe0f093df9b6b8fcd2b94d94a6862bf026710fdc19313300
MD5 ff4f974edc82b1008dce2d528f0f6ef2
BLAKE2b-256 c3c13572bba0f382d27f8bfc357bb288b9dca8b986ce4e024e19cdea0511b415

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-pp311-pypy311_pp73-manylinux_2_28_x86_64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-pp311-pypy311_pp73-macosx_11_0_arm64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-pp311-pypy311_pp73-macosx_11_0_arm64.whl
Algorithm Hash digest
SHA256 2919697556edb0864d7ed22d6dc16082e43ffe61b9c48f2d1b540d7f0ef3a85b
MD5 d12ca25e6b3f8cdaf1d81764c96bda34
BLAKE2b-256 42099d9832c5595ce485c49b6d15f070fe537da9fd52b7fe7f5aa230b4ef34d8

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-pp311-pypy311_pp73-macosx_11_0_arm64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-pp311-pypy311_pp73-macosx_10_12_x86_64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-pp311-pypy311_pp73-macosx_10_12_x86_64.whl
Algorithm Hash digest
SHA256 9962f7a09e09cbad9a941bab9f5e77eca34d9195a3b621a183a02acc06d545f7
MD5 ff7fd6e2b4111ef0b2a47ea7b3ccfe2a
BLAKE2b-256 e8e067f9014f06e2745ec81963a51dda20cd72401c99bf2e3ed92e526c0c7af4

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-pp311-pypy311_pp73-macosx_10_12_x86_64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp315-cp315t-musllinux_1_2_x86_64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp315-cp315t-musllinux_1_2_x86_64.whl
Algorithm Hash digest
SHA256 788b1301e4199caf003b4db7651b8474de555a4bbea31e7b7f9b5d0ab59acbe4
MD5 b92e034772c316d52f2f27d8d54ee999
BLAKE2b-256 4d89a39e159a1f08e681b6dbe638bd34e1cc89b9c0ec16e6f4c418c6ebda8b83

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp315-cp315t-musllinux_1_2_x86_64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp315-cp315t-musllinux_1_2_aarch64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp315-cp315t-musllinux_1_2_aarch64.whl
Algorithm Hash digest
SHA256 84761a97f4232a0f957359d23940239658f9bdf24a1c0f9046ea8b810a7b9bf8
MD5 8167e487b3793b0fdf5ed65a02e869fd
BLAKE2b-256 9e198b4b2b50947233669c53cf309c10598a91990b30e9924185774efe06af04

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp315-cp315t-musllinux_1_2_aarch64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp315-cp315t-manylinux_2_28_x86_64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp315-cp315t-manylinux_2_28_x86_64.whl
Algorithm Hash digest
SHA256 8c00e563c0f4adcfeeb37a12c91f79b9ac3d5dbbaa81b67c67c7befbf51399dd
MD5 196c7c5d9b7117a8c93c100d4f013600
BLAKE2b-256 4e081c41ec211e489e6f6a83f708f31cc7f3dd622984e5db73b56a60bbd742bf

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp315-cp315t-manylinux_2_28_x86_64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp315-cp315t-manylinux_2_28_aarch64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp315-cp315t-manylinux_2_28_aarch64.whl
Algorithm Hash digest
SHA256 ddbe131d6d8d62418c7043299d5bab48b61dae75af8877e1b29aa07db76c7fe7
MD5 de650d1a19c75eeda53ea13c0dfcadb0
BLAKE2b-256 9e9d8d8198e2eef32bb0141c283ae645e65a9e9500144c1bc120aac5c9b27b7f

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp315-cp315t-manylinux_2_28_aarch64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp315-cp315t-macosx_11_0_arm64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp315-cp315t-macosx_11_0_arm64.whl
Algorithm Hash digest
SHA256 5a29acedcafc8b05026bd8e68a8c8276585e242b5b78e2e1632e86fc6f843af5
MD5 7e4bec2743e8a5d01c094ccbe5719388
BLAKE2b-256 83bbfc37d8db1b8fbee261e02dedfc0c3d96d5b58ab7e2eb21abd7ebe8327743

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp315-cp315t-macosx_11_0_arm64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp315-cp315t-macosx_10_12_x86_64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp315-cp315t-macosx_10_12_x86_64.whl
Algorithm Hash digest
SHA256 8bda70e19276a1047e6aa9dc9ff4108bf905e370403af864f70997545fa91fd6
MD5 56f00f855686f5934ad0f607c0c7a9a6
BLAKE2b-256 f613c35d38e45dc22033b6b594ea4494beb2b29a9538b0c20a189d14bb7f6245

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp315-cp315t-macosx_10_12_x86_64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp314-cp314t-win_arm64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp314-cp314t-win_arm64.whl
Algorithm Hash digest
SHA256 408696247c2a76a088228622f84166c1741ca860fbdd73a2da6da8a3be82f770
MD5 f2b1bba7530dfb86d7027ba665d6d847
BLAKE2b-256 145e6ac81ee7095a1547b0189bc1914213e3d81ea976e85a3cd33e9d1550cdc8

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp314-cp314t-win_arm64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp314-cp314t-win_amd64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp314-cp314t-win_amd64.whl
Algorithm Hash digest
SHA256 b61791f3b380a469899ed6592e80b09f6dab8001656f403d87945a5e8c6cc9dc
MD5 fc38c64413d897c344d92f45b2c98e93
BLAKE2b-256 35f09577ba123f7f76b56d197c1796330d81269fbda384c3d0a12b83fe81a789

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp314-cp314t-win_amd64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp314-cp314t-musllinux_1_2_x86_64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp314-cp314t-musllinux_1_2_x86_64.whl
Algorithm Hash digest
SHA256 fbb0ed7850907e7c086fcc6a7a0081b920e14115805b1cffcfc7955cdda1b1ab
MD5 40fcb0004241d26c0693c2ffc3765dd8
BLAKE2b-256 1260ab30c2bd0750b17520565d203c695b7b5882db4a3f12e446e63d0c0aff8c

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp314-cp314t-musllinux_1_2_x86_64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp314-cp314t-musllinux_1_2_aarch64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp314-cp314t-musllinux_1_2_aarch64.whl
Algorithm Hash digest
SHA256 741421eea1651416cc8a3148bdaddba24c1017a7cd7bc10981dec78b2634e13e
MD5 81ddab7104ce6183099019bcb6bb20a3
BLAKE2b-256 79369333df0b779abf06eddbfeed2459906e39f2648fbd643a0c5be0f0c131b2

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp314-cp314t-musllinux_1_2_aarch64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp314-cp314t-manylinux_2_28_x86_64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp314-cp314t-manylinux_2_28_x86_64.whl
Algorithm Hash digest
SHA256 45c6ce7505000eead0d20dd7c85a7475593060abbfd1da7ac42eca50c25ea9b1
MD5 091026900d24afb1694637f2e59ecd19
BLAKE2b-256 f9cfe313e7803528fa513052e06cb4919f2a01941245bc5e13b8f413466498fe

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp314-cp314t-manylinux_2_28_x86_64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp314-cp314t-manylinux_2_28_aarch64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp314-cp314t-manylinux_2_28_aarch64.whl
Algorithm Hash digest
SHA256 3ac6f44801e2a5e0fa3218cd6b8290ea9c325a2fc2ddde14ddb83eb82c1778c2
MD5 8e3b181216eee13ef752e3fad8f6312e
BLAKE2b-256 cb58e3a8aa7602103b284615e210cdf20f35fffe691a4a0846397eb3dfd3fc1f

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp314-cp314t-manylinux_2_28_aarch64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp314-cp314t-macosx_11_0_arm64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp314-cp314t-macosx_11_0_arm64.whl
Algorithm Hash digest
SHA256 4c6d90ea54f3eeb15ff06c345104693fbfb87fa42ea53d7bdc4b04e8d97856c2
MD5 94ed6b386401ba15b965a66bd618babc
BLAKE2b-256 207132ad1b30c06616c88fd075d193e785272fafd320540d8a36c6d277f50f40

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp314-cp314t-macosx_11_0_arm64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp314-cp314t-macosx_10_12_x86_64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp314-cp314t-macosx_10_12_x86_64.whl
Algorithm Hash digest
SHA256 bf46e4f60f087e1a359e33effcde9270a927d590e5b9c764611a1a78e8831659
MD5 0e5df0c9c54e6162e26ec9ae2a07b26f
BLAKE2b-256 a61c103de3efab203c1687174c3d177a9a0bfbdcf6ea8ed26ff28bd19d6417d9

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp314-cp314t-macosx_10_12_x86_64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp310-abi3-win_arm64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp310-abi3-win_arm64.whl
Algorithm Hash digest
SHA256 f050a0263409849f54b8be3c8f67cb6f8571a8313249a2d96869431fd0aba3fd
MD5 af3d8276e7ce8561ff43300ed0c3ae43
BLAKE2b-256 6413c6d6c7b5a48df9c48ca505bb5568d805e6f719744da72fcb3df33a33e389

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp310-abi3-win_arm64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp310-abi3-win_amd64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp310-abi3-win_amd64.whl
Algorithm Hash digest
SHA256 f3e1e069ac3ca19155141fce7a2169e9024417b84ebd13ae329a69ef2b654e0b
MD5 766d974aa2c57b41ab18dd5cb561ec85
BLAKE2b-256 9466184948df178013554670e94b78539f5d990e97c18d33a2694decbf0f4927

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp310-abi3-win_amd64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp310-abi3-musllinux_1_2_x86_64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp310-abi3-musllinux_1_2_x86_64.whl
Algorithm Hash digest
SHA256 40af5aedbc8086399f80e2ef0e241228191c49f262269701682310873a173d6a
MD5 a19dd0cf279f369bb00d13d00c8a80c8
BLAKE2b-256 d1a9e273526c106c8c35abb698dd86f7f1c73c82f3727dd2cb13ea41c751b965

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp310-abi3-musllinux_1_2_x86_64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp310-abi3-musllinux_1_2_aarch64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp310-abi3-musllinux_1_2_aarch64.whl
Algorithm Hash digest
SHA256 a496270cbd61701073f8f116771d09494afbe2361fbd78c8253c70128e794724
MD5 62d0d1274670443e5a9d1eba4298adc7
BLAKE2b-256 991b1a8fc355a29f4a8a3c4fd5d62162010c7eb3e8c1bbcb956d8706cf1c4757

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp310-abi3-musllinux_1_2_aarch64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp310-abi3-manylinux_2_31_riscv64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp310-abi3-manylinux_2_31_riscv64.whl
Algorithm Hash digest
SHA256 c76ebf2f2250dfb77dba40d024272ae98c4f6ba1d93f90c0b17eca9db2922233
MD5 eddc6cd3b49762af94425e336bf32ef1
BLAKE2b-256 2b9498d90c75342ab96aa2a6f98581b067f07cf2070b0af90506c4f960819ad0

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp310-abi3-manylinux_2_31_riscv64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp310-abi3-manylinux_2_28_x86_64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp310-abi3-manylinux_2_28_x86_64.whl
Algorithm Hash digest
SHA256 77d4efee5c35c5a80d7c4b652123d5006c4e90af1d7ba160fdbabfb91fd16b90
MD5 72f61ff2f9905af7fc014ae7f1d7dd74
BLAKE2b-256 c14359d488e8372b3fe8f6570873ae2b3607586d0256208ae9aa35bfd34c5f61

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp310-abi3-manylinux_2_28_x86_64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp310-abi3-manylinux_2_28_aarch64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp310-abi3-manylinux_2_28_aarch64.whl
Algorithm Hash digest
SHA256 b9aa327c2a93cddccaa6478383f7f537c157342b6d957b9c58b0f012e7e4033f
MD5 4cd36fd49a204a2152288e826544a419
BLAKE2b-256 e2bbc640b28a3e51e8c57334764216afd525add70cb0399b121a03ed662b944b

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp310-abi3-manylinux_2_28_aarch64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp310-abi3-macosx_11_0_arm64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp310-abi3-macosx_11_0_arm64.whl
Algorithm Hash digest
SHA256 1177fb838c7a22bee4ebe82e0e2abf58840536625e41801089b8b8f16d438a42
MD5 66c9a941591e16435ff13182437efe66
BLAKE2b-256 adea5ac93c4a6979bf79e7d91301ef0b3ff7d988b6ff1336777576884db11124

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp310-abi3-macosx_11_0_arm64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file tox_toml_fmt-1.10.1-cp310-abi3-macosx_10_12_x86_64.whl.

File metadata

File hashes

Hashes for tox_toml_fmt-1.10.1-cp310-abi3-macosx_10_12_x86_64.whl
Algorithm Hash digest
SHA256 a406ae0eace5ba09e5b3b5b42b37f2d2f7012d8180707461046dd1be597e7f56
MD5 5979555d8c6babe2839b4918a43bce45
BLAKE2b-256 9fec6a3465d3f444046d37fa4b0a6831cf3bb2c4c4334930e5d232c3af6dc006

See more details on using hashes here.

Provenance

The following attestation bundles were made for tox_toml_fmt-1.10.1-cp310-abi3-macosx_10_12_x86_64.whl:

Publisher: tox_toml_fmt_build.yaml on tox-dev/toml-fmt

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

Release history Release notifications | RSS feed

1.10.3

27 files

1.10.2

27 files

This release

1.10.1 This release

27 files

1.10.0

27 files

1.9.3

28 files

1.9.2

11 files

1.9.1

11 files

1.9.0

11 files

1.8.0

11 files

1.7.2

11 files

1.7.1

11 files

1.7.0

11 files

1.6.0

11 files

1.5.4

11 files

1.5.3

11 files

1.5.2

11 files

1.5.1

11 files

1.5.0

11 files

1.4.0

11 files

1.3.0

11 files

1.2.2

16 files

1.2.1

16 files

1.2.0

16 files

1.1.0

19 files

1.0.0

22 files

Anthropic, PBC Visionary sponsor Bloomberg Visionary sponsor Hudson River Trading Visionary sponsor Meta Visionary sponsor NVIDIA Visionary sponsor Microsoft Sustainability sponsor Depot Continuous Integration AWS Cloud computing and Security Sponsor Datadog Monitoring Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page