| Source | Content | Access |
|---|---|---|
| VMR (ICTV Virus Metadata Resource) | taxonomic hierarchy + exemplar isolates + GenBank/RefSeq accessions | local, embedded TSV |
| NCBI E-utilities | sequence metadata, sequences (nt/aa), NCBI taxonomy | remote, on demand |
| ICTV Report | descriptive chapter text per family (with figures) | remote, on demand |
| ICTV Report trees | per-family Newick trees + amino-acid/nucleotide alignments | local, bundled |
The VMR is the local index; remote sources are fetched on demand and cached.
Installation
pip install viralfetch
This installs the viralfetch command and everything it needs in one step —
including Pillow (for drawing chapter figures) and alv/Biopython (for the
alignment viewer). Python 3.10+ is required.
NCBI configuration
Commands that reach NCBI (seq, tax --ncbi, tax --compare-ncbi, text,
update) require a real email address, per NCBI usage policy. There is no
default — the command fails with an explanation if none is set. Until one is
configured, every viralfetch call prints a reminder on stderr listing the
ways to set it (stdout stays clean, so --json output is unaffected).
export NCBI_EMAIL="you@example.com"
export NCBI_API_KEY="..." # optional; raises the rate limit from 3 to 10 req/s
You can also pass --email / --api-key on any command.
Session vs. persisted. An export (or --email) applies only to the
current shell session. To store the email permanently, use:
viralfetch config --store-ncbi-email you@example.com
This writes to the config file (see viralfetch config), which survives across
sessions. Running viralfetch config warns you when no email is persisted yet.
Global options
These go before the command:
| Option | Effect |
|---|---|
--json |
Emit pure JSON on stdout (warnings/errors go to stderr) — ready for jq. |
--no-cache |
Ignore the cache and refetch. |
--verbose |
Extra diagnostics on stderr. |
--email, --api-key |
Override the NCBI credentials for this run. |
Run viralfetch COMMAND --help to see a command's own arguments and options.
tax — taxonomy lineage (local, NCBI only as a fallback)
Show the full ICTV lineage of a taxon (realm → species) as aligned rank/name
columns, with the queried taxon marked ◀. Case-insensitive,
with "did you mean" suggestions on a near miss. A species also gets an isolate
summary.
If the name is not in the local VMR, tax automatically looks it up in NCBI
taxonomy and shows that lineage instead (with a note on stderr). The fallback
is best-effort: with no NCBI email configured, or if NCBI is unreachable or
knows no such taxon, it reports "not found" with the usual suggestions.
viralfetch tax "Human immunodeficiency virus 1"
# stderr: 'Human immunodeficiency virus 1' is not in the local VMR; showing its
# NCBI taxonomy lineage instead.
viralfetch tax Coronaviridae
╭─ Coronaviridae (family) ──╮
│ realm Riboviria │
│ kingdom Orthornavirae │
│ phylum Pisuviricota │
│ class Pisoniviricetes │
│ order Nidovirales │
│ suborder Cornidovirineae │
│ family Coronaviridae ◀ │
╰────────────────────────────╯
Same query as JSON:
viralfetch --json tax Coronaviridae
{
"name": "Coronaviridae",
"rank": "family",
"lineage": {
"realm": "Riboviria",
"kingdom": "Orthornavirae",
"phylum": "Pisuviricota",
"class": "Pisoniviricetes",
"order": "Nidovirales",
"suborder": "Cornidovirineae",
"family": "Coronaviridae"
}
}
tax --ncbi (remote)
Look the lineage up directly in NCBI's taxonomy database instead of the
local VMR — useful for a name the VMR does not carry (a non-viral host, a very
recent taxon, an NCBI synonym). The name is resolved to a taxid via esearch,
then its lineage is fetched. Requires an NCBI email (see above).
viralfetch tax "SARS-CoV-2" --ncbi
╭─ SARS-CoV-2 (species) ────╮
│ realm Riboviria │
│ … … │
│ family Coronaviridae │
│ species SARS-CoV-2 ◀ │
╰────────────────────────────╯
NCBI taxonomy — taxid 2697049
With --json the payload is {source: "ncbi", taxid, name, rank, lineage}. An
unknown name exits 1. --ncbi and --compare-ncbi are mutually exclusive.
tax --compare-ncbi (remote)
Fetch the NCBI taxonomy lineage for a representative accession and render it beside the ICTV lineage, highlighting divergences. Divergences are expected — NCBI commonly lags ICTV — and are the point of the command.
viralfetch tax "Betacoronavirus pandemicum" --compare-ncbi
ICTV vs NCBI lineage — Betacoronavirus pandemicum
┏━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━┳━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━┓
┃ ICTV (VMR) ┃ NCBI (taxid 227984) ┃
┡━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━╇━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━┩
│ realm: Riboviria │ acellular root: Viruses │
│ kingdom: Orthornavirae │ realm: Riboviria │
│ … │ … │
│ species: Betacoronavirus pandemicum │ species: Betacoronavirus pandemi… │
│ │ no rank: SARS coronavirus Tor2 │
└─────────────────────────────────────┴────────────────────────────────────┘
members — child taxa (local, no network)
List the taxa below a given taxon.
At a specific rank
viralfetch members Coronaviridae --rank genus
genera in family Coronaviridae
┏━━━━━━━━━━━━━━━━━━┳━━━━━━━━━┓
┃ genus ┃ species ┃
┡━━━━━━━━━━━━━━━━━━╇━━━━━━━━━┩
│ Alphacoronavirus │ 26 │
│ Alphaletovirus │ 1 │
│ Alphapironavirus │ 1 │
│ Betacoronavirus │ 14 │
│ Deltacoronavirus │ 7 │
│ Gammacoronavirus │ 5 │
└──────────────────┴─────────┘
6 genera
Counts only
viralfetch members Riboviria --rank family --count
158 families in realm Riboviria
Per-rank breakdown (no flags)
viralfetch members Coronaviridae
members of family
Coronaviridae by rank
┏━━━━━━━━━━━┳━━━━━━━┓
┃ rank ┃ count ┃
┡━━━━━━━━━━━╇━━━━━━━┩
│ subfamily │ 3 │
│ genus │ 6 │
│ subgenus │ 28 │
│ species │ 54 │
└───────────┴───────┘
Tip: add --tree to list every member of Coronaviridae as a hierarchy.
Full descendant tree
viralfetch members Coronaviridae --tree
Coronaviridae (family)
├── Letovirinae (subfamily)
│ └── Alphaletovirus (genus)
│ └── Milecovirus (subgenus)
│ └── Alphaletovirus microhylae (species)
├── Orthocoronavirinae (subfamily)
│ ├── Alphacoronavirus (genus)
│ │ ├── Amalacovirus (subgenus)
│ │ │ └── Alphacoronavirus almalfi (species)
│ │ └── …
│ └── …
└── …
91 descendant taxa
--rank, --tree, and the breakdown all work with --json too.
seq — NCBI sequence data (remote)
Accessions are resolved locally from the VMR, then metadata or records are
fetched from NCBI. Output formats are mutually exclusive; --meta is the
default.
| Flag | Fetches |
|---|---|
--meta |
metadata via esummary (~1 KB/accession) |
--fasta |
FASTA sequences via efetch |
--gb |
full GenBank records via efetch |
Metadata for a species
viralfetch seq "Betacoronavirus pandemicum" --meta
nuccore metadata — Betacoronavirus pandemicum
┏━━━━━━━━━━━━┳━━━━━━━━━━━━━━━━━━━━━┳━━━━━━━┳━━━━━━━━━┳━━━━━━━━━┳━━━┈
┃ accession ┃ organism ┃ len ┃ moltype ┃ biomol ┃ …
┡━━━━━━━━━━━━╇━━━━━━━━━━━━━━━━━━━━━╇━━━━━━━╇━━━━━━━━━╇━━━━━━━━━╇━━━┈
│ AY274119.3 │ SARS coronavirus… │ 29751 │ rna │ genomic │ …
│ AY613950.1 │ SARS coronavirus… │ 29728 │ rna │ genomic │ …
│ MN908947.3 │ SARS-CoV-2 Wuhan-… │ 29903 │ rna │ genomic │ …
│ KY352407.1 │ SARS-related coro… │ 29274 │ rna │ genomic │ …
└────────────┴─────────────────────┴───────┴─────────┴─────────┴───┈
(Columns topology, completeness, sourcedb and updatedate are shown too;
trimmed here for width. Add --json for the full, untruncated records.)
Download FASTA to a file
viralfetch seq "Betacoronavirus pandemicum" --fasta -o out.fa
Wrote 4 fasta record(s) for Betacoronavirus pandemicum to out.fa
Without -o, records go to stdout (pipeable), and the summary goes to stderr.
A whole taxon
--taxon operates on every species beneath a taxon. With --meta it shows a
local aggregate (no network) so you can decide whether a download is worth
it:
viralfetch seq --taxon Coronaviridae --meta
╭─ Coronaviridae (family) — download estimate ─╮
│ species 54 │
│ isolates 59 │
│ accessions 59 │
│ RefSeq 0 │
╰──────────────────────────────────────────────╯
by genome composition
┏━━━━━━━━━━━━━┳━━━━━━━━━━━━┓
┃ composition ┃ accessions ┃
┡━━━━━━━━━━━━━╇━━━━━━━━━━━━┩
│ ssRNA(+) │ 59 │
└─────────────┴────────────┘
{
"name": "Coronaviridae",
"rank": "family",
"species": 54,
"isolates": 59,
"accessions": 59,
"refseq": 0,
"moltype_breakdown": { "ssRNA(+)": 59 }
}
Fetches of more than 500 accessions ask for confirmation unless --yes is
given (in --json / non-interactive mode they refuse without --yes).
Molecule selection
--moltype and --biomol are db=nuccore fields, filtered locally over the
metadata (matching is lenient — --moltype ssRNA matches ss-RNA):
viralfetch seq --taxon Filoviridae --moltype ssRNA --fasta -o filo.fa
viralfetch seq "Betacoronavirus pandemicum" --biomol genomic
--protein is a separate path, not a nuccore filter: proteins live in
db=protein, reached via elink (nuccore → protein).
viralfetch seq "Betacoronavirus pandemicum" --protein --fasta
text — ICTV Report chapter (remote)
Fetch the ICTV Report chapter for a family, convert its main content to
Markdown, and render it with headings, subsection titles, characteristic
tables, and the italics of scientific names preserved. The original page
URL and the chapter's references/attribution are shown at the top, and the
content is CC BY 4.0. Figures are kept as image links; --images also
draws them in the terminal (see below).
viralfetch text Coronaviridae
Family: Coronaviridae
Source: https://ictv.global/report/chapter/coronaviridae/coronaviridae
Patrick C.Y. Woo, Raoul J. de Groot, Bart Haagmans, Susanna K.P. Lau, …
The citation for this ICTV Report chapter is the summary published as:
Woo et al., (2023), ICTV Virus Taxonomy Profile: Coronaviridae 2023,
Journal of General Virology (2023) 104, 001843
Content is licensed CC BY 4.0 (https://creativecommons.org/licenses/by/4.0/).
────────────────────────────────────────────────────────────────────────
Summary
Members of the family Coronaviridae, a monophyletic group of viruses in
the order Nidovirales, are enveloped, positive-sense RNA viruses …
A single section
--section restricts the output to one section, matched by heading
(case-insensitive substring). The top attribution block is always kept.
viralfetch text Coronaviridae --section summary
Raw Markdown to a file
--raw emits the pure Markdown (no Rich decoration), ready to redirect:
viralfetch text Geminiviridae --raw > geminiviridae.md
# Family: Geminiviridae
*Source: https://ictv.global/report/chapter/geminiviridae/geminiviridae*
**Elvira Fiallo-Olivé, Jean-Michel Lett, Darren P. Martin, …**
The citation for this ICTV Report chapter is the summary published as
Fiallo-Olivé et al., ICTV Virus Taxonomy Profile: *Geminiviridae* 2021, …
With --json, the command emits {slug, title, url, doi, images, markdown}
instead — images is a list of {url, alt} for the chapter's figures, whose
absolute URLs also appear inline in the Markdown as .
Figures in the terminal
--images draws the chapter's figures in their original place in the text,
as truecolor Unicode block-element graphics sized to your terminal (full width
by default, for the sharpest picture). Each character cell packs a 2×2 grid of
sub-pixels with a per-cell best-fit of two colours; the image is downscaled in
linear light (LANCZOS) and error-diffusion dithered, so gradients stay smooth.
It renders the same on any truecolor terminal — no special graphics protocol
required. Each figure keeps its alt as a caption. It applies only to the
interactive Rich view (not --raw, --json, or when piped):
viralfetch text Coronaviridae --images
viralfetch text Coronaviridae --images --fig-width 60 # cap the size
Figures are fetched politely (rate-limited, robots.txt-honouring, from the
ICTV domain only) and cached permanently. A missing or broken figure is skipped,
never fatal.
Genera and species resolve to their family chapter
The ICTV Report is organised by family — genera and species have no chapter
of their own. Given one, text looks it up in the VMR and shows its family's
chapter, with a note on stderr (so --raw/--json stdout stays clean):
viralfetch text Betacoronavirus
# stderr: 'Betacoronavirus' is a genus; the ICTV Report has no genus chapter
# — showing its family, Coronaviridae.
# stdout: the Coronaviridae chapter
Names the VMR doesn't know fall back to NCBI
If a name is absent from the local VMR, text asks NCBI taxonomy for its
family before giving up, and — if NCBI places it in one — shows that family's
chapter (with a note on stderr). This catches recent taxa and NCBI synonyms the
bundled VMR predates:
viralfetch text "some-recent-virus"
# stderr: 'some-recent-virus' is not in the local VMR; NCBI places it in
# family Rhabdoviridae — showing that chapter.
# stdout: the Rhabdoviridae chapter
The fallback is best-effort: if NCBI is unreachable or knows no family, the name
is tried verbatim and, failing that, gets "did you mean" suggestions and exit
code 1.
Fetching honours ictv.global/robots.txt, sends a descriptive User-Agent
carrying your contact email, waits at least 1 second between requests, and
caches chapter HTML for 30 days.
tree — phylogenetic tree (local, NCBI only as a fallback)
Show the ICTV Report phylogenetic tree for a taxon's family, drawn as an indented cladogram. Trees are bundled locally (Newick + metadata + a tip→virus table per family), so this works offline.
The name is resolved through the VMR to its family, and the tip(s) it points at are highlighted: a species highlights its own tip, a genus its whole clade, a family shows the tree with nothing highlighted. A name the VMR does not know is searched for among every tree's members (so a virus member name that is not an ICTV taxon still finds its tree).
Failing that, the name is looked up in NCBI taxonomy — which knows strains, synonyms and taxa newer than the bundled VMR. Its lineage names the family (the same family names ICTV uses), and the deepest rank the trees do record — species → subgenus → genus → subfamily — highlights the query's closest relatives on that tree. The note on stderr always says which rank was used:
viralfetch tree "Dengue virus 2"
# 'Dengue virus 2' is not in the local VMR; NCBI places it in family
# Flaviviridae — no tip matches 'dengue virus type 2' itself, so its subgenus
# 'Euflavivirus' is highlighted instead (closest relatives on the tree).
This step is the only one that touches the network, and it is best-effort: with
no NCBI email configured (viralfetch config --store-ncbi-email you@example.com)
or no connection it is silently skipped, leaving the offline behaviour intact.
msa resolves names the same way.
viralfetch tree "Betacoronavirus pandemicum"
Coronaviridae · Figure 5A · RdRp (AA) · maximum likelihood · 55 tips · 2 matches
┌─ Alphacoronavirus BT020
┌─┤
│ └─ Scotophilus bat coronavirus 512
─┤ …
│ ┌ severe acute respiratory syndrome coronavirus ← match
└─────┤
└ severe acute respiratory syndrome coronavirus 2 ← match
Caption: Figure 5 Coronaviridae. Phylogenetic relationships among members …
Other trees for Coronaviridae: --tree 2 (helicase)
When a family has several trees, pick one with --tree N; the query defaults to
whichever tree contains the match. Other options:
| Option | Effect |
|---|---|
--tree N |
Choose a tree when a family has several (1-based). |
--newick |
Emit the raw Newick string to stdout (for piping to other tools). |
--chapter |
Show the family's bundled ICTV Report chapter text instead. |
--newick and --json keep stdout clean (the redirect note goes to stderr).
With --json, the command emits {family, source, note, matched_rank, matched_value, tree: {…, matched, newick}, other_trees} — source is
vmr, member or ncbi, and matched_rank/matched_value say what the
highlight fell back to. An unknown name gets "did you mean" suggestions and exit
code 1; a family with no bundled tree exits 1 with a note.
msa — multiple sequence alignment (local, no network)
Show the alignment behind a family's tree — the aligned FASTA that sits beside
each Newick — coloured by residue and wrapped into blocks with a column ruler
(via alv). The name is resolved to its
family exactly as tree does, and the query's own records are marked ▶.
The alignments run to thousands of columns, so the view defaults to a
leading column window that fits your terminal; move or widen it with --range.
viralfetch msa "Betacoronavirus pandemicum" --consensus
Coronaviridae · tree1 · AA · cols 1–60 of 316 · 55 seqs · 2 matches
consensus KHFFFAQDGDAAITDYDYYRYNRPTMLDICQALFVYEVVDKYFDIYEGGCITAKEVVVTN
▶ severe acute respir KHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNN
Alphapironavirus bona EHFFYLQPRDCAVTDFDYYRFNRPTVLDPLQFRFVYNVVKHYFKSYSAGCLKSEFVIINN
… 0^ 20^ 40^
| Option | Effect |
|---|---|
--tree N |
Choose a tree when a family has several (1-based). |
--range A:B |
Column window, 1-based inclusive (100:180; either bound may be omitted). |
--consensus |
Prepend a per-column majority-residue row. |
--fasta |
Emit the (windowed) alignment as FASTA to stdout. |
With --json, the command emits {family, tree_id, molecule, total_cols, start, n_cols, matched, consensus, rows: [{name, seq, matched}]}. A family whose tree
has no bundled alignment exits 1 with a note.
Utilities
Small helper commands, all local except update.
viralfetch diagnose # VMR parser quality (zero-accession rows)
viralfetch update # is a newer VMR published on ictv.global?
viralfetch config # show email, masked API key, cache paths
# (warns if no NCBI email is persisted yet)
viralfetch config --store-ncbi-email you@example.com # persist email
viralfetch config --store-ncbi-apikey KEY # persist API key
viralfetch cache info # per-namespace entry counts and size
viralfetch cache clear --texts # drop cached ICTV chapters (or --seqs, --images, or all)
diagnose reports the parser's quality indicator — how many VMR rows yielded
zero accessions:
╭─ VMR accession-parser diagnostics ─╮
│ isolates 19271 │
│ accessions 23249 │
│ empty-accession rows 141 │
│ unparsed rows 0 │
╰────────────────────────────────────╯
Shell completion: taxon names complete from the VMR
(viralfetch tax Corona<TAB> → Coronaviridae). Install it once with
viralfetch --install-completion.
Output & exit codes
- Rich tables/panels/trees by default;
--jsonfor clean,jq-ready output. Colour is disabled automatically when stdout is not a TTY. - Errors go to stderr with a non-zero exit code:
1not found,2bad usage,3missing NCBI email,4NCBI request failed. - Partial failures are reported, never swallowed: if you request 200 accessions and 197 come back, the 3 missing ones are listed.
Caching
Immutable data (sequences, accession metadata, and chapter figures) is cached
permanently; ICTV chapter HTML uses a 30-day TTL. The cache lives in the
platform cache directory. Use --no-cache to bypass it for a single run.
Release files for viralfetch 0.1.4
For a detailed explanation of source distributions (sdists) and built distributions (wheels), please see the package formats documentation.
Source distribution (sdist)
| File | Size | Uploaded | |
|---|---|---|---|
| viralfetch-0.1.4.tar.gz | 8.5 MB | Details |
Built distribution (wheel)
| File | Interpreter | ABI | Platform | Reset |
|---|---|---|---|---|
| viralfetch-0.1.4-py3-none-any.whl | Python 3 | none | any | Details |
Total release size: 17.1 MB