esmc-protein-function 1.0.0

An Evolutionary-scale Model (ESM) for protein function prediction from amino acid sequences using the Gene Ontology (GO).

ESMC Protein Function Predictor

An Evolutionary-scale Model (ESM) for protein function prediction from amino acid sequences using the Gene Ontology (GO). Based on the ESM Cambrian Transformer architecture, pre-trained on UniRef, MGnify, and the Joint Genome Institute's database and fine-tuned on the AmiGO Boost protein function dataset, this protein language model predicts the GO subgraph for a particular protein sequence - giving you insight into the molecular function, biological process, and location of the activity inside the cell.

Key Features

• Sequence-to-function prediction — Predicts Molecular Function, Biological Process, and Cellular Component ontologies directly from raw amino acid sequences, eliminating the need for homology searches, structural data, or multiple sequence alignments.

• Hierarchy-aware GO subgraph reconstruction — Outputs a full GO directed acyclic graph (DAG) ensuring predictions respect the ontology structure rather than treating each term as an independent binary label.

• Efficient inference at scale — Supports weight quantization and quantization-aware training (QAT), enabling memory-efficient, high-throughput screening of large sequence datasets without accuracy loss.

What are GO terms?

"The Gene Ontology (GO) is a concept hierarchy that describes the biological function of genes and gene products at different levels of abstraction (Ashburner et al., 2000). It is a good model to describe the multi-faceted nature of protein function."

"GO is a directed acyclic graph. The nodes in this graph are functional descriptors (terms or classes) connected by relational ties between them (is_a, part_of, etc.). For example, terms 'protein binding activity' and 'binding activity' are related by an is_a relationship; however, the edge in the graph is often reversed to point from binding towards protein binding. This graph contains three subgraphs (subontologies): Molecular Function (MF), Biological Process (BP), and Cellular Component (CC), defined by their root nodes. Biologically, each subgraph represent a different aspect of the protein's function: what it does on a molecular level (MF), which biological processes it participates in (BP) and where in the cell it is located (CC)."

From CAFA 5 Protein Function Prediction

V1 Pretrained Models

The following pretrained models are available on HuggingFace Hub and require the esmc-protein-function library version 1.x.x for inference. All V1 models have been optimized with quantization-aware post-training.

Name	Embedding Dimensions	Encoder Layers	Context Length	Total Parameters
andrewdalpino/ESMC-Protein-Function-V1-300M	960	30	2048	397M

V0 Pretrained Models

The following pretrained models are available on HuggingFace Hub and require the esmc_function_classifier library version 0.1.x for inference.

Name	Embedding Dimensions	Encoder Layers	Context Length	Total Parameters
andrewdalpino/ESMC-Protein-Function-V0-300M	960	30	2048	361M
andrewdalpino/ESMC-Protein-Function-V0-300M-QAT	960	30	2048	361M
andrewdalpino/ESMC-Protein-Function-V0-600M	1152	36	2048	644M
andrewdalpino/ESMC-Protein-Function-V0-600M-QAT	1152	36	2048	644M

Basic Pretrained Example

First, install the esmc-protein-function package using pip.

pip install esmc-protein-function

Then, we'll load the model weights from HuggingFace Hub by calling the from_pretrained() method. We'll also need the ESM tokenizer from the esm library. Then, tokenize the sequence and query the model like in the example below.

import torch

from esm.tokenization import EsmSequenceTokenizer

from esmc_protein_function.model import ESMCProteinFunction


model_name = "andrewdalpino/ESMC-Protein-Function-V1-300M"

sequence = "MPPKGHKKTADGDFRPVNSAGNTIQAKQKYSIDDLLYPKSTIKNLAKETLPDDAIISKDALTAIQRAATLFVSYMASHGNASAEAGGRKKIT"

top_p = 0.5

tokenizer = EsmSequenceTokenizer()

model = ESMCProteinFunction.from_pretrained(model_name)

out = tokenizer(sequence, max_length=2048, truncation=True)

input_ids = torch.tensor(out["input_ids"], dtype=torch.int32)

go_term_probabilities = model.predict_terms(
    input_ids, top_p=top_p
)

Predict GO Subgraph

You can also output the gene-ontology (GO) networkx subgraph for a given sequence like in the example below. You'll need an up-to-date gene ontology database that you can import using the obonet package.

pip install obonet

Then, load the GO DAG and call the predict_all_subgraphs() method like in the example below.

import networkx as nx

import obonet


# Visit https://geneontology.org/docs/download-ontology/ to download.
go_db_path = "./dataset/go-basic.obo"

graph = obonet.read_obo(go_db_path)

model.load_gene_ontology(graph)

subgraph, go_term_probabilities = model.predict_all_subgraphs(
    input_ids, top_p=top_p
)

json = nx.node_link_data(subgraph)

print(json)

Quantized Model

To quantize the model weights using int8 call the quantize_weights() method. Any model can be quantized, but we recommend one that has been quantization-aware trained (QAT) for the best performance. The group_size argument controls the granularity at which quantization scales are computed.

model.quantize_weights(group_size=64)

References

• T. Hayes, et al. Simulating 500 million years of evolution with a language model, 2024.
• M. Ashburner, et al. Gene Ontology: tool for the unification of biology, 2000.