fastfold-ai 0.1.0

Official Python SDK and CLI for the FastFold API

FastFold Python SDK and CLI

Python client and CLI for the FastFold Jobs API.

Installation

From the project root:

pip install .

Or for development:

pip install -e .

Requires Python 3.8+.

Authentication

Set your API key in the environment:

export FASTFOLD_API_KEY="sk-...your-api-key"

You can also pass an API key when creating the client or via the CLI flag --api-key.

SDK Usage

from fastfold import Client

client = Client()  # Reads FASTFOLD_API_KEY from env by default

response = client.fold.create(
    sequence="[LL-37, 37 aa]",
    model="boltz-2",
)

print(response.id)  # jobId

Advanced options:

job = client.fold.create(
    sequence="...",
    model="boltz-2",
    name="My Job",
    from_id=None,  # maps to ?from=<uuid>
    params={"recyclingSteps": 3},  # merged into params
    constraints={
        "pocket": [
            {
                "binder": {"chain_id": "A"},
                "contacts": [{"chain_id": "B", "res_idx": 10}],
            }
        ]
    },
)

CLI Usage

Submit a folding job:

fastfold fold --sequence "[LL-37, 37 aa]" --model boltz-2

Optional flags:

fastfold fold \
  --sequence "..." \
  --model boltz-2 \
  --name "My Job" \
  --api-key "sk-..." \
  --base-url "https://api.fastfold.ai"

On success the CLI prints the created job ID to stdout.

Python API Reference (minimal)

• Client(api_key: Optional[str] = None, base_url: Optional[str] = None, timeout: float = 30.0)
  • Reads FASTFOLD_API_KEY if api_key is not provided.
• Client.fold.create(sequence: str, model: str, name: Optional[str] = None, from_id: Optional[str] = None, params: Optional[dict] = None, constraints: Optional[dict] = None) -> Job
  • Returns a Job object with id, run_id, name, status, sequence_ids, and raw.