Skip to main content

Official Python SDK and CLI for the FastFold API

Project description

FastFold SDK

Python SDK and CLI for FastFold jobs, workflows, library operations, and reports.

Open In Colab

Installation

Install from PyPI:

pip install fastfold-ai

Or for development:

pip install -e .

Requires Python 3.8+.

Authentication

Set your API key in the environment:

export FASTFOLD_API_KEY="sk-...your-api-key"

You can also pass an API key when creating the client or via the CLI flag --api-key.

SDK Usage

The SDK exposes both typed helpers and capability-oriented services:

  • client.fold for the simplest fold-job flow
  • client.jobs for raw payloads, YAML submission, polling, and rendering helpers
  • client.workflows for generic workflow create/get/status/task-results/execute/YAML APIs
  • client.library for library item creation and file uploads
  • client.openmm, client.openmmdl, and client.boltzgen for the most common multi-step workflow flows
  • client.reports for Slack markdown report submission

For end-to-end walkthroughs, downloadable input files, and additional variants, see:

Fold job

Create a fold job, wait for completion, then inspect the returned artifacts:

from fastfold import Client

client = Client()

job = client.fold.create(
    sequence="[LL-37, 37 aa]",
    model="boltz-2",
    is_public=True,
)

results = client.jobs.wait_for_completion(job.id, poll_interval=5.0, timeout=900.0)
print(results.job.status)
print(results.cif_url())
print(results.metrics().mean_PLDDT)
print(results.get_viewer_link())

OpenMM first run from local files

Submit an OpenMM workflow from a local structure file and its matching PAE JSON:

from fastfold import Client

client = Client()
workflow = client.openmm.submit_from_manual_files(
    pdb_path="./protein.pdb",
    pae_path="./pae.json",
    simulation_name="AF-P00698",
    residue_profile="calvados3",
    temp=293.15,
    ionic=0.15,
    ph=7.5,
    step_size_ns=0.01,
    sim_length_ns=10.0,
    box_length=50,
)
print(workflow.workflow_id)

OpenMMDL from local files

Submit an OpenMMDL workflow from local topology and ligand files:

from fastfold import Client

client = Client()
workflow = client.openmmdl.submit_from_local_files(
    topology_path="./KEAP1kd.pdb",
    ligand_paths=["./IQK.sdf"],
    simulation_name="KEAP1 + IQK",
    input_json={
        "smallMoleculeMode": "single",
        "equilibration": "only_minimization",
        "sim_length_ns": 0.05,
        "step_time_ps": 0.002,
        "failure_retries": 0,
        "addWater": False,
        "addMembrane": False,
        "boxType": "geometry",
        "geomPadding": 1.0,
        "geometryDropdown": "cube",
        "membranePadding": 2.0,
        "writeDCD": True,
        "dcdFrames": 5,
        "pdbInterval_ns": 0.05,
        "writeData": False,
        "writeCheckpoint": False,
    },
)
print(workflow.workflow_id)

BoltzGen minimal workflow

Create a draft BoltzGen workflow, upload a minimal workflow.yml, and execute it:

from pathlib import Path

from fastfold import Client

client = Client()
draft = client.boltzgen.create_draft(name="boltzgen_demo")
client.boltzgen.upsert_workflow_yml(
    draft.workflow_id,
    Path("fastfold/examples/boltzgen/minimal.workflow.yml").read_text(),
)
client.boltzgen.execute(draft.workflow_id)
print(draft.workflow_id)

For preset bundles, downloadable design-spec files, and multi-spec examples, see BoltzGen.

Slack report sharing

Send a markdown report and optionally persist it as a library item:

from fastfold import Client

client = Client()
result = client.reports.send_agent_cli_report(
    "## Demo Report\n\n- Workflow completed.\n- Artifacts are ready.",
    report_name="demo_report",
)
print(result.ok, result.library_item_id)

CLI Usage

The CLI keeps fastfold-cli fold working, but it now also exposes resource-oriented subcommands. For the complete command matrix, see CLI.

# Fold job
fastfold-cli fold --sequence "[LL-37, 37 aa]" --model boltz-2

# OpenMM first run from local files
fastfold-cli workflows openmm from-manual-files \
  --pdb ./protein.pdb \
  --pae ./pae.json \
  --simulation-name AF-P00698 \
  --force-field calvados3 \
  --temperature 293.15 \
  --ionic 0.15 \
  --ph 7.5 \
  --step-size-ns 0.01 \
  --sim-length-ns 10 \
  --box-length 50

# OpenMMDL from local files
fastfold-cli workflows openmmdl from-local-files \
  --topology ./KEAP1kd.pdb \
  --ligand ./IQK.sdf \
  --simulation-name "KEAP1 + IQK" \
  --input-json fastfold/examples/openmmdl/workflow_input.json

# BoltzGen draft
fastfold-cli workflows boltzgen create-draft --name demo

# Report sharing
fastfold-cli reports slack --markdown-file fastfold/examples/reports/sample_report.md

Most create and inspection commands are script-friendly: they print IDs by default, or full JSON with --json.

Packaged Examples

Small, reusable text assets ship under fastfold/examples/:

  • fastfold/examples/fold/job_payload.json
  • fastfold/examples/openmm/from_manual_files.json
  • fastfold/examples/openmm/from_fold_job.json
  • fastfold/examples/openmmdl/workflow_input.json
  • fastfold/examples/openmmdl/from_local_files.json
  • fastfold/examples/openmmdl/quick_water_box.workflow_input.json
  • fastfold/examples/openmmdl/quick_membrane.workflow_input.json
  • fastfold/examples/boltzgen/minimal.workflow.yml
  • fastfold/examples/boltzgen/design_spec.example.yaml
  • fastfold/examples/boltzgen/replacements.example.json
  • fastfold/examples/fold/boltz2_affinity_input.yaml
  • fastfold/examples/reports/sample_report.md

Larger reference bundles and downloadable preset files live in the docs:

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

fastfold_ai-0.2.0.tar.gz (25.3 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

fastfold_ai-0.2.0-py3-none-any.whl (33.7 kB view details)

Uploaded Python 3

File details

Details for the file fastfold_ai-0.2.0.tar.gz.

File metadata

  • Download URL: fastfold_ai-0.2.0.tar.gz
  • Upload date:
  • Size: 25.3 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.13.12

File hashes

Hashes for fastfold_ai-0.2.0.tar.gz
Algorithm Hash digest
SHA256 6c2ac5eb18d5fbc44b683a6cfe41967f566addee29f0c6eadc0b00ca69c5770f
MD5 a42709eae7c182793f8624e7480d501f
BLAKE2b-256 21b5e30008dad061a936400832c153896baa330b6e19a68ce4946d495ad31711

See more details on using hashes here.

Provenance

The following attestation bundles were made for fastfold_ai-0.2.0.tar.gz:

Publisher: python-publish.yml on fastfold-ai/fastfold-python

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file fastfold_ai-0.2.0-py3-none-any.whl.

File metadata

  • Download URL: fastfold_ai-0.2.0-py3-none-any.whl
  • Upload date:
  • Size: 33.7 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.13.12

File hashes

Hashes for fastfold_ai-0.2.0-py3-none-any.whl
Algorithm Hash digest
SHA256 e46554e09aa7b94811c7a88a3c53bef31077992a0b4157d099ccc96a73ebede1
MD5 189541178c800c9726991b73d7375d30
BLAKE2b-256 1892eaae61dcff498ed8860f09a1d6574a1d31f6f77044ba2d7b554d9563b8bf

See more details on using hashes here.

Provenance

The following attestation bundles were made for fastfold_ai-0.2.0-py3-none-any.whl:

Publisher: python-publish.yml on fastfold-ai/fastfold-python

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page