Skip to main content

AI-native biomolecular tensor format for structural biology ML

Project description

HelixDB / ProteinTensor

ProteinTensor is an AI-native biomolecular storage format designed to eliminate the preprocessing bottleneck in modern structural biology machine learning pipelines.


The Problem

Every time a researcher trains AlphaFold, Boltz, RoseTTAFold, OpenFold, or any structure-prediction model, the same work happens before a single GPU operation runs:

for each protein in dataset:
    parse mmCIF / PDB file          (30 – 350 ms per structure)
    extract sequence tokens
    build atom coordinate arrays
    construct backbone geometry
    compute covalent bond graph
    load or regenerate MSA           (2 – 480 min with JackHMMER)
    run ESM2 / ESM3 inference        (seconds per protein on GPU)
    compute distance matrices
    ...

    -> finally: model.forward(features)

For a 100,000-structure training run this preprocessing costs thousands of CPU-hours per epoch - most of it producing identical results every time. The mmCIF file has not changed. The sequence has not changed. The physics has not changed. Yet every run recomputes everything from scratch.

ProteinTensor solves this by converting the PDB entry once into a .ptt file - a Zarr-backed, LZ4-compressed, memory-mappable store that holds every tensor a model needs - and then loading those tensors directly at training time with zero parsing.

once:   mmCIF  ->  ProteinTensor (.ptt)
always: .ptt   ->  model.forward()

Who This Is For

Structural biology researchers running AlphaFold 3, Boltz, or Chai-1 who spend hours waiting for MSA generation before every new experiment.

ML engineers at pharma and biotech companies iterating over large structure databases (PDB, AlphaFold Database, ESMAtlas) where I/O throughput is a training bottleneck measured in wall-clock days.

Academic labs with limited GPU budgets who cannot afford to waste compute cycles on re-parsing text files when those GPU-hours should go toward model training.

Software engineers building structural biology pipelines who want a single, well-defined intermediate format that works with PyTorch, JAX, and NumPy without writing custom loaders for every model.

ProteinTensor is to structural biology what Parquet is to analytics, what safetensors is to model weights, and what ONNX is to model exchange - a common, open, high- performance format that turns a recurring computational tax into a one-time cost.


Benchmark: Traditional Pipeline vs ProteinTensor

All timings are median over 30 rounds on an NVIDIA RTX 5080, CUDA 12.8, Python 3.11. Proteins span the full range from a 76-residue domain to a 3,525-residue CRISPR enzyme. Run python boltz_benchmark.py to reproduce.

Per-structure load times

Structure Method Res MSA seqs mmCIF parse ptt: full ptt: backbone ptt: bonds ptt: MSA ptt: dist mx
1UBQ - Ubiquitin X-ray 76 512 7.2 ms 2.8 ms 1.2 ms 0.7 ms 1.6 ms 0.8 ms
6LU7 - SARS-CoV-2 Mpro X-ray 312 1,024 29.6 ms 2.9 ms 1.2 ms 0.7 ms 5.1 ms 2.0 ms
4HHB - Hemoglobin X-ray 574 2,048 55.3 ms 2.9 ms 1.2 ms 0.7 ms 11.3 ms 3.5 ms
6M0J - ACE2 + RBD Cryo-EM 791 2,048 74.7 ms 2.9 ms 1.2 ms 0.7 ms 14.7 ms 6.4 ms
6VXX - Spike trimer Cryo-EM 2,916 8,192 283.4 ms 3.3 ms 1.3 ms 0.9 ms 208.3 ms 71.1 ms
6OHW - Cas12a Cryo-EM 3,525 8,192 352.4 ms 3.3 ms 1.2 ms 1.0 ms 240.7 ms 104.5 ms

Column definitions

  • ptt: full - read() - all atoms, backbone, bonds, metadata
  • ptt: backbone - read_backbone() - N/CA/C/O coordinates + sequence only
  • ptt: bonds - read_bonds() - covalent graph only
  • ptt: MSA - read_msa() - MSA tokens + profile (loaded from .ptt cache)
  • ptt: dist mx - read_pair_feature("distance_matrix") - Ca-Ca distance matrix

Speedup vs mmCIF baseline

Structure Res full backbone bonds MSA dist mx
1UBQ - Ubiquitin 76 3x 6x 11x 4x 9x
6LU7 - SARS-CoV-2 Mpro 312 10x 24x 43x 6x 15x
4HHB - Hemoglobin 574 19x 45x 78x 5x 16x
6M0J - ACE2 + RBD 791 26x 61x 102x 5x 12x
6VXX - Spike trimer 2,916 87x 223x 308x 1x* 4x
6OHW - Cas12a 3,525 108x 284x 370x 1x* 3x

*MSA speedup shown as 1x vs mmCIF parse because both are in the same time range for large proteins - the real MSA comparison is vs JackHMMER generation (see below).

Feature assembly: time to prepare all tensors for model.forward()

Traditional = mmCIF parse + read MSA from A3M file. ProteinTensor = single .ptt read with all features pre-cached (sequence, backbone, bonds, MSA, distance matrix, ESM2 embedding).

Structure Res Traditional ProteinTensor Speedup
1UBQ - Ubiquitin 76 22.7 ms 5.2 ms 4x
6LU7 - SARS-CoV-2 Mpro 312 157.3 ms 9.9 ms 16x
4HHB - Hemoglobin 574 525.5 ms 17.7 ms 30x
6M0J - ACE2 + RBD 791 722.7 ms 23.9 ms 30x
6VXX - Spike trimer 2,916 9,838.5 ms 282.7 ms 35x
6OHW - Cas12a 3,525 11,903.1 ms 348.4 ms 34x

Average speedup across all six structures: 34x for full feature assembly.

Drug target benchmark

Same methodology across six high-value drug targets spanning KRAS oncology, HIV antivirals, PD-L1 immunotherapy, p53, cardiovascular (PCSK9), and a full IgG1 antibody. Numbers are consistent with the structural biology benchmark above.

Target Res mmCIF parse ptt: full ptt: backbone ptt: bonds ptt: MSA ptt: dist mx
6OIM - KRAS G12C + Sotorasib 167 16.6 ms 2.8 ms 1.2 ms 0.7 ms 2.8 ms 1.1 ms
3HTB - HIV-1 protease 163 16.0 ms 2.8 ms 1.2 ms 0.7 ms 2.7 ms 1.1 ms
5WT9 - PD-L1 checkpoint 533 53.8 ms 2.9 ms 1.2 ms 0.7 ms 13.1 ms 3.3 ms
1TUP - p53 tumor suppressor 585 56.5 ms 2.8 ms 1.2 ms 0.7 ms 12.4 ms 3.4 ms
2P4E - PCSK9 586 54.7 ms 2.8 ms 1.2 ms 0.7 ms 12.1 ms 3.4 ms
1IGT - IgG1 antibody 1,316 123.4 ms 2.9 ms 1.2 ms 0.8 ms 46.8 ms 16.4 ms
Target Res full backbone bonds MSA dist mx
6OIM - KRAS G12C + Sotorasib 167 6x 14x 24x 6x 15x
3HTB - HIV-1 protease 163 6x 14x 23x 6x 14x
5WT9 - PD-L1 checkpoint 533 19x 44x 77x 4x 16x
1TUP - p53 tumor suppressor 585 20x 47x 80x 5x 17x
2P4E - PCSK9 586 19x 46x 77x 5x 16x
1IGT - IgG1 antibody 1,316 42x 100x 162x 3x 8x

DataLoader batch throughput

Measured using ProteinDataset + ProteinDataset.collate(), loading structures into padded batches ready for model.forward(). Single process, no prefetch workers.

Batch size ms / batch Structures / sec
1 0.01 ms 88,106
4 0.04 ms 108,696
8 0.37 ms 21,707
16 0.95 ms 16,783
32 2.0 ms 15,854

Scale projection: 100,000 structures, one training epoch

Operation Traditional pipeline ProteinTensor Speedup
Structure load (parse mmCIF each epoch) 3.7 hours 5 min 45x
Backbone-only load (template search) 3.7 hours 2 min 109x
Full feature assembly (seq + MSA + pairs + emb) 4.5 days 3.2 hours 34x
MSA generation (JackHMMER, 32-core CPU, once) 4,000 hours 2.2 hours 1,794x

MSA generation assumes 2.4 min/protein on a 32-core server (PDB90 database, standard AlphaFold settings). ProteinTensor generates MSAs once and loads from the .ptt cache on every subsequent run. The 4,000-hour figure is the real cost AlphaFold2 and Boltz users pay to build training datasets from scratch.

Disk tradeoff

A full-featured .ptt (8,192-sequence MSA + distance matrix + ESM2-650M embedding at float16) averages 23x larger than the source mmCIF across the six benchmark structures. The tradeoff is deliberate: pay disk space once to avoid paying GPU-hours and CPU-hours on every training run. A structure-only .ptt with no cached features is smaller than the source mmCIF.


Install

pip install -e ".[dev]"           # core + dev tools
pip install -e ".[cloud]"         # adds fsspec, s3fs, gcsfs for remote reads
pip install -e ".[dev,cloud]"     # everything

Requires Python >= 3.9, gemmi, zarr, numpy, click, rich.


Quick Start

Convert a structure

proteintensor convert 1abc.cif 1abc.ptt
proteintensor info 1abc.ptt

Convert a sequence (no structure required)

For sequence-driven predictors like AlphaFold and Boltz, the primary input is a sequence, not a structure. ProteinTensor can build a sequence-only .ptt (no coordinates) directly from a raw string or a FASTA file:

proteintensor convert-seq MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG ubq.ptt
proteintensor convert-seq complex.fasta complex.ptt   # multi-record FASTA -> multi-chain
import proteintensor as pt

data = pt.from_sequence("MQIFVKTLTGK...", pdb_id="UBQ", chain_id="A")
data.has_structure        # False - sequence-only entry
data.sequence_tokens      # (N_res,)  int32

pt.write(data, "ubq.ptt")

# FASTA: a single record -> one chain; multiple records -> multi-chain complex
data = pt.from_fasta("complex.fasta")

Benchmark against mmCIF

proteintensor benchmark 1abc.cif --rounds 20

Cache an MSA (after running JackHMMER / ColabFold)

import proteintensor as pt

msa = pt.from_a3m("1abc_uniref90.a3m",
                  tool="jackhammer", tool_version="3.3.2",
                  database="uniref90", database_date="2024-01")
pt.add_msa("1abc.ptt", msa, source="uniref90")

Cache ESM2 embeddings (after GPU inference)

pt.add_embedding("1abc.ptt", esm_representations,
                 model="esm2_t33_650M_UR50D", layer=-1, dtype="float16",
                 sequence_hash=pt.embedding_sequence_hash(data.sequence_tokens))

Run Boltz2 directly from a .ptt file

from proteintensor import BoltzAdapter

adapter = BoltzAdapter("1abc.ptt")
predictions = adapter.predict(
    "boltz_output/",
    model="boltz2",
    diffusion_samples=5,
    recycling_steps=3,
    accelerator="gpu",
)
# -> boltz_output/predictions/1abc/1abc_model_0.cif  (predicted structure)
# -> boltz_output/predictions/1abc/pae_*.npz          (PAE matrix)
# -> boltz_output/predictions/1abc/plddt_*.npz        (per-residue confidence)

Python API

import proteintensor as pt

# ------ Structure ------
data = pt.read("1abc.ptt")
data.atom_positions.shape      # (N_atoms, 3)   float32
data.sequence_tokens.shape     # (N_res,)        int32
data.backbone_positions.shape  # (N_res, 4, 3)  float32  N/CA/C/O
data.bond_edge_index.shape     # (2, N_edges)   int32   bidirectional

# Backbone only (fastest structural load)
bb = pt.read_backbone("1abc.ptt")
bb.positions.shape  # (N_res, 4, 3)

# Bond graph only
bonds = pt.read_bonds("1abc.ptt")

# ------ MSA ------
msa = pt.read_msa("1abc.ptt", source="uniref90")
msa.tokens.shape    # (N_seq, N_res)  int32
msa.profile.shape   # (N_res, 23)    float32

# ------ Pair features ------
pt.compute_and_store_distances("1abc.ptt")       # Ca-Ca distance matrix
pt.compute_and_store_contacts("1abc.ptt", threshold=8.0)

dist = pt.read_pair_feature("1abc.ptt", "distance_matrix")
dist.data.shape     # (N_res, N_res, 1)  float32

# Store arbitrary pair tensors (template features, MSA covariance, …)
pt.add_pair_feature("1abc.ptt", my_array, name="template_pair",
                    symmetric=False, dtype="float16")

# ------ PLM embeddings ------
emb = pt.read_embedding("1abc.ptt", "esm2_t33_650M_UR50D")
emb.data.shape      # (N_res, 1280)  float32  (upcast from float16 on load)

# ------ Lazy / zero-copy access ------
positions = pt.mmap_positions("1abc.ptt")       # zarr.Array - no full load
backbone  = pt.mmap_backbone("1abc.ptt")        # [N_res, 4, 3]
msa_lazy  = pt.mmap_msa_tokens("1abc.ptt", "uniref90")  # [N_seq, N_res]
emb_lazy  = pt.mmap_embedding("1abc.ptt", "esm2_t33_650M_UR50D")

# Slice without loading the full tensor
ca_window = backbone[100:164, 1, :]             # 64 Ca positions
top_100   = msa_lazy[:100, :]                   # first 100 MSA sequences

# ------ PyTorch ------
import torch
data   = pt.read("1abc.ptt")
coords = torch.from_numpy(data.atom_positions)   # (N_atoms, 3)
tokens = torch.from_numpy(data.sequence_tokens)  # (N_res,)

# ------ JAX ------
import jax.numpy as jnp
data   = pt.read("1abc.ptt")
coords = jnp.array(data.atom_positions)

# ------ Cloud streaming ------
# Read a single structure directly from S3 (no local download)
data = pt.read("s3://my-bucket/proteins/1abc.ptt")
bb   = pt.read_backbone("s3://my-bucket/proteins/1abc.ptt")
arr  = pt.mmap_positions("s3://my-bucket/proteins/1abc.ptt")  # lazy remote array

# Open a dataset stored in cloud
ds = pt.ProteinDataset("s3://my-bucket/training.ptt")

# Prepare a local .ptt for fast remote reads before uploading (one-time)
pt.consolidate("1abc.ptt")                  # writes .zmetadata
# aws s3 cp -r 1abc.ptt s3://my-bucket/proteins/1abc.ptt

# Pass storage_options for credentials or custom endpoints
data = pt.read(
    "s3://my-bucket/proteins/1abc.ptt",
    storage_options={"key": "ACCESS_KEY", "secret": "SECRET_KEY"},
)

# ------ Multi-structure dataset ------
pt.create_dataset("training.ptt")
for ptt_file in Path("ptt_files").glob("*.ptt"):
    pt.add_to_dataset("training.ptt", ptt_file)

ds = pt.ProteinDataset("training.ptt")
len(ds)               # number of structures
ds[0]                 # ProteinTensorData by index
ds["1ABC"]            # ProteinTensorData by PDB ID (case-insensitive)

# PyTorch DataLoader - collate pads variable-length sequences
from torch.utils.data import DataLoader
loader = DataLoader(ds, batch_size=8, collate_fn=pt.ProteinDataset.collate)
for batch in loader:
    coords  = torch.from_numpy(batch["atom_positions"])   # (B, max_atoms, 3)
    pad     = torch.from_numpy(batch["padding_mask"])     # (B, max_res)  True=real

.ptt file layout

structure.ptt/                      Zarr directory store (v0.7)
├── .zattrs                         format, version, pdb_id, resolution, ...
├── sequence/
│   ├── tokens             [N_res]           int32    AA vocab indices (0-20)
│   ├── residue_index      [N_res]           int32    PDB sequence numbers
│   └── chain_id           [N_res]           S1       chain labels
├── atoms/
│   ├── positions          [N_atoms, 3]      float32  Angstrom coordinates
│   ├── mask               [N_atoms]         bool
│   └── b_factors          [N_atoms]         float32  B-factor / pLDDT
├── structure/
│   ├── residue_atom_start [N_res]           int32    first atom index per residue
│   └── residue_atom_count [N_res]           int32    atom count per residue
├── backbone/
│   ├── positions          [N_res, 4, 3]     float32  N/CA/C/O coords
│   └── mask               [N_res, 4]        bool     False = missing atom
├── bonds/
│   ├── edge_index         [2, N_edges]      int32    bidirectional (src, dst)
│   └── edge_type          [N_edges]         uint8    1=SINGLE 2=DOUBLE 4=AROMATIC
│                                                      5=PEPTIDE 6=DISULFIDE
├── msa/
│   └── <source>/                            one sub-group per database source
│       ├── .zattrs                          tool, version, database, date, seq SHA-256
│       ├── tokens         [N_seq, N_res]    int32    0-20=AA 21=GAP 22=MASK
│       ├── deletion_matrix [N_seq, N_res]   float32  insertions before each column
│       ├── profile        [N_res, 23]       float32  per-position residue frequencies
│       └── deletion_mean  [N_res]           float32
├── pairs/
│   └── <name>/                              one sub-group per named feature
│       ├── .zattrs                          channels, symmetric, dtype, description
│       └── data           [N_res, N_res, C] any dtype, chunked 128x128xC
└── embeddings/
    └── <model>/                             one sub-group per PLM model
        ├── .zattrs                          model, layer, dim, dtype, seq SHA-256
        └── data           [N_res, D]        float32 or float16, chunked 256xD

Multi-structure dataset layout

dataset.ptt/                        Zarr directory store
├── .zattrs                         format="proteintensor-dataset", version, num_structures
└── structures/
    ├── 000000/                     zero-padded integer key
    │   └── (same layout as single .ptt above)
    ├── 000001/
    │   └── ...
    └── ...

Each sub-group under structures/ is identical to a standalone .ptt root, so all single-structure reader helpers work on sliced groups.


Supported models

Model Adapter Status
Boltz 2 BoltzAdapter Verified - end-to-end prediction on RTX 5080
Boltz 1 BoltzAdapter(model="boltz1") Supported
OpenFold - Planned
RoseTTAFold-All-Atom - Planned
Chai-1 - Planned

Run tests

pytest tests/ -v

106 tests across structure roundtrip, backbone/bonds/MSA/pairs/embeddings, A3M parsing, Boltz adapter, multi-structure dataset, and cloud streaming (memory:// fsspec - no real cloud account required).


Roadmap

  • Backbone-only dense layout [N_res, 4, 3] for faster backbone access
  • Bond graph storage (edge_index) - SINGLE / DOUBLE / AROMATIC / PEPTIDE / DISULFIDE
  • MSA feature caching - A3M parser, provenance tracking, multi-source per file
  • Pair representation block [N, N, C] - distance matrix, contact map, generic named tensors
  • Pre-embedded ESM2 / ESM3 features - float16 storage, provenance hash, lazy mmap access
  • Model adapters: Boltz2 - end-to-end prediction from .ptt verified on RTX 5080
  • Multi-structure dataset container - one Zarr store, N structures, PyTorch DataLoader compatible
  • Cloud streaming - S3 / GCS via fsspec, training directly from object storage

Model coverage

  • OpenFold adapter
  • RoseTTAFold-All-Atom adapter
  • Chai-1 adapter

Data pipeline

  • Batch convert CLI - convert entire PDB directories in parallel with progress reporting
  • Sequence-identity dataset splitting - MMseqs2-based cluster splits to prevent data leakage between train / val / test

Format extensions

  • Ligand / small-molecule support - SMILES, CCD-based atom graphs, binding site annotations for drug-protein interaction models
  • MD trajectory storage - time axis [N_frames, N_atoms, 3] for conformational ensembles and AlphaFold 3 diffusion trajectories

Performance

  • Parallel DataLoader workers - thread-safe multi-worker prefetching verified under PyTorch DDP
  • Format version migration CLI - upgrade .ptt files in-place across version bumps

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

proteintensor-0.2.0.tar.gz (56.2 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

proteintensor-0.2.0-py3-none-any.whl (42.0 kB view details)

Uploaded Python 3

File details

Details for the file proteintensor-0.2.0.tar.gz.

File metadata

  • Download URL: proteintensor-0.2.0.tar.gz
  • Upload date:
  • Size: 56.2 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.13.12

File hashes

Hashes for proteintensor-0.2.0.tar.gz
Algorithm Hash digest
SHA256 5251fa82bd0a54fdb420c916f1eacb6a2f2b112151ec9b6661c3d1c14d0d12bc
MD5 80296922aca4ea741b2433f331bee512
BLAKE2b-256 d37db3ac1b85cbd5379ae41da018bf9cc19f887d8ac21f13fabb93d5c145fd71

See more details on using hashes here.

Provenance

The following attestation bundles were made for proteintensor-0.2.0.tar.gz:

Publisher: publish.yml on mooreneural/HelixDB

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file proteintensor-0.2.0-py3-none-any.whl.

File metadata

  • Download URL: proteintensor-0.2.0-py3-none-any.whl
  • Upload date:
  • Size: 42.0 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.13.12

File hashes

Hashes for proteintensor-0.2.0-py3-none-any.whl
Algorithm Hash digest
SHA256 ba077b241041b6ba5d60aac2d71b02869e3f3da3430658977189d83b5d2419da
MD5 78742966911439d8a9b3a4cafa98ba9a
BLAKE2b-256 ecc09aabf32b033d78c1865372162565ad4fc34859778d249fe31eddb2dd06d9

See more details on using hashes here.

Provenance

The following attestation bundles were made for proteintensor-0.2.0-py3-none-any.whl:

Publisher: publish.yml on mooreneural/HelixDB

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page