AI-native biomolecular tensor format for structural biology ML
Project description
ProteinTensor Introduction
ProteinTensor is an AI-native biomolecular storage format designed to eliminate the preprocessing bottleneck in modern structural biology machine learning pipelines.
The Problem
Every time a researcher trains AlphaFold, Boltz, RoseTTAFold, OpenFold, or any structure-prediction model, the same work happens before a single GPU operation runs:
for each protein in dataset:
parse mmCIF / PDB file (30 – 350 ms per structure)
extract sequence tokens
build atom coordinate arrays
construct backbone geometry
compute covalent bond graph
load or regenerate MSA (2 – 480 min with JackHMMER)
run ESM2 / ESM3 inference (seconds per protein on GPU)
compute distance matrices
...
-> finally: model.forward(features)
For a 100,000-structure training run this preprocessing costs thousands of CPU-hours per epoch - most of it producing identical results every time. The mmCIF file has not changed. The sequence has not changed. The physics has not changed. Yet every run recomputes everything from scratch.
ProteinTensor solves this by converting the PDB entry once into a .ptt file - a
Zarr-backed, LZ4-compressed, memory-mappable store that holds every tensor a model
needs - and then loading those tensors directly at training time with zero parsing.
once: mmCIF -> ProteinTensor (.ptt)
always: .ptt -> model.forward()
Who This Is For
Structural biology researchers running AlphaFold 3, Boltz, or Chai-1 who spend hours waiting for MSA generation before every new experiment.
ML engineers at pharma and biotech companies iterating over large structure databases (PDB, AlphaFold Database, ESMAtlas) where I/O throughput is a training bottleneck measured in wall-clock days.
Academic labs with limited GPU budgets who cannot afford to waste compute cycles on re-parsing text files when those GPU-hours should go toward model training.
Software engineers building structural biology pipelines who want a single, well-defined intermediate format that works with PyTorch, JAX, and NumPy without writing custom loaders for every model.
ProteinTensor is to structural biology what Parquet is to analytics, what safetensors is to model weights, and what ONNX is to model exchange - a common, open, high- performance format that turns a recurring computational tax into a one-time cost.
Benchmark: Traditional Pipeline vs ProteinTensor
All timings are median over 30 rounds on a Windows workstation (RTX 5080, Python
3.11.9); mmCIF parsing and .ptt reads are CPU-bound, so these reflect CPU
performance. Proteins span the full range from a 76-residue domain to a
3,525-residue CRISPR enzyme. Run python boltz_benchmark.py to reproduce.
Per-structure load times
| Structure | Method | Res | MSA seqs | mmCIF parse | ptt: full | ptt: backbone | ptt: bonds | ptt: MSA | ptt: dist mx |
|---|---|---|---|---|---|---|---|---|---|
| 1UBQ - Ubiquitin | X-ray | 76 | 512 | 7.4 ms | 3.2 ms | 1.3 ms | 0.8 ms | 1.8 ms | 0.8 ms |
| 6LU7 - SARS-CoV-2 Mpro | X-ray | 312 | 1,024 | 28.7 ms | 3.3 ms | 1.3 ms | 0.8 ms | 5.2 ms | 1.9 ms |
| 4HHB - Hemoglobin | X-ray | 574 | 2,048 | 54.1 ms | 3.3 ms | 1.3 ms | 0.8 ms | 11.5 ms | 3.6 ms |
| 6M0J - ACE2 + RBD | Cryo-EM | 791 | 2,048 | 73.2 ms | 3.3 ms | 1.4 ms | 0.8 ms | 15.3 ms | 6.9 ms |
| 6VXX - Spike trimer | Cryo-EM | 2,916 | 8,192 | 283.9 ms | 3.7 ms | 1.4 ms | 1.0 ms | 213.7 ms | 74.7 ms |
| 6OHW - Cas12a | Cryo-EM | 3,525 | 8,192 | 346.5 ms | 3.7 ms | 1.3 ms | 1.0 ms | 243.9 ms | 107.3 ms |
Column definitions
ptt: full-read()- all atoms, backbone, bonds, metadataptt: backbone-read_backbone()- N/CA/C/O coordinates + sequence onlyptt: bonds-read_bonds()- covalent graph onlyptt: MSA-read_msa()- MSA tokens + profile (loaded from .ptt cache)ptt: dist mx-read_pair_feature("distance_matrix")- Ca-Ca distance matrix
Speedup vs mmCIF baseline
| Structure | Res | full | backbone | bonds | MSA | dist mx |
|---|---|---|---|---|---|---|
| 1UBQ - Ubiquitin | 76 | 2x | 6x | 10x | 4x | 9x |
| 6LU7 - SARS-CoV-2 Mpro | 312 | 9x | 21x | 38x | 5x | 15x |
| 4HHB - Hemoglobin | 574 | 17x | 40x | 70x | 5x | 15x |
| 6M0J - ACE2 + RBD | 791 | 22x | 54x | 92x | 5x | 11x |
| 6VXX - Spike trimer | 2,916 | 76x | 201x | 285x | 1x* | 4x |
| 6OHW - Cas12a | 3,525 | 95x | 257x | 343x | 1x* | 3x |
*MSA speedup shown as 1x vs mmCIF parse because both are in the same time range for large proteins - the real MSA comparison is vs JackHMMER generation (see below).
Feature assembly: time to prepare all tensors for model.forward()
Traditional = mmCIF parse + A3M MSA parse + distance-matrix compute. ProteinTensor
= read the structure, MSA, distance matrix, and ESM2 embedding from a single
pre-cached .ptt. Reproduce with python benchmarks/assembly_benchmark.py
(MSA depth and embedding shape are realistic; numeric content is synthetic, so
timing reflects tensor dimensions, not values).
| Structure | Res | MSA depth | Traditional | ProteinTensor | Speedup |
|---|---|---|---|---|---|
| 1UBQ - Ubiquitin | 76 | 512 | 14.1 ms | 7.1 ms | 2.0x |
| 6LU7 - SARS-CoV-2 Mpro | 312 | 1,024 | 48.7 ms | 13.6 ms | 3.6x |
| 4HHB - Hemoglobin | 574 | 2,048 | 118.0 ms | 22.7 ms | 5.2x |
| 6M0J - ACE2 + RBD | 791 | 2,048 | 196.4 ms | 38.3 ms | 5.1x |
| 6VXX - Spike trimer | 2,916 | 8,192 | 1,395 ms | 309 ms | 4.5x |
| 6OHW - Cas12a | 3,525 | 8,192 | 1,462 ms | 381 ms | 3.8x |
Average speedup across all six structures: 4x for full feature assembly
(measured on a Windows CPU box - see
benchmarks/ASSEMBLY_RESULTS.md).
On an earlier 34x figure: prior versions reported ~34x here. That number was measured against ProteinTensor's original scalar A3M parser, which dominated the traditional side (~11 s to parse an 8,192-deep MSA). Vectorizing that parser in v0.2.0 cut the traditional baseline ~8x, so the fair feature-assembly speedup is now ~4x. The
.pttread side was unchanged - only the baseline got faster.
Drug target benchmark
Same methodology across six high-value drug targets spanning KRAS oncology, HIV antivirals, PD-L1 immunotherapy, p53, cardiovascular (PCSK9), and a full IgG1 antibody. Numbers are consistent with the structural biology benchmark above.
| Target | Res | mmCIF parse | ptt: full | ptt: backbone | ptt: bonds | ptt: MSA | ptt: dist mx |
|---|---|---|---|---|---|---|---|
| 6OIM - KRAS G12C + Sotorasib | 167 | 17.1 ms | 3.4 ms | 1.3 ms | 0.8 ms | 3.0 ms | 1.3 ms |
| 3HTB - HIV-1 protease | 163 | 16.5 ms | 3.3 ms | 1.4 ms | 0.8 ms | 2.8 ms | 1.3 ms |
| 5WT9 - PD-L1 checkpoint | 533 | 54.8 ms | 3.8 ms | 1.4 ms | 0.8 ms | 11.9 ms | 3.8 ms |
| 1TUP - p53 tumor suppressor | 585 | 57.4 ms | 3.4 ms | 1.4 ms | 0.8 ms | 13.0 ms | 4.0 ms |
| 2P4E - PCSK9 | 586 | 55.4 ms | 3.4 ms | 1.4 ms | 0.8 ms | 12.8 ms | 4.1 ms |
| 1IGT - IgG1 antibody | 1,316 | 127.3 ms | 3.5 ms | 1.4 ms | 0.8 ms | 47.1 ms | 17.9 ms |
| Target | Res | full | backbone | bonds | MSA | dist mx |
|---|---|---|---|---|---|---|
| 6OIM - KRAS G12C + Sotorasib | 167 | 5x | 13x | 22x | 6x | 13x |
| 3HTB - HIV-1 protease | 163 | 5x | 12x | 21x | 6x | 13x |
| 5WT9 - PD-L1 checkpoint | 533 | 15x | 40x | 69x | 5x | 14x |
| 1TUP - p53 tumor suppressor | 585 | 17x | 42x | 71x | 4x | 14x |
| 2P4E - PCSK9 | 586 | 16x | 41x | 70x | 4x | 14x |
| 1IGT - IgG1 antibody | 1,316 | 37x | 92x | 156x | 3x | 7x |
DataLoader batch throughput
Measured using ProteinDataset + ProteinDataset.collate(), loading structures into
padded batches ready for model.forward(). Single process, no prefetch workers.
| Batch size | ms / batch | Structures / sec |
|---|---|---|
| 1 | 0.01 ms | 97,088 |
| 4 | 0.03 ms | 116,279 |
| 8 | 0.42 ms | 19,242 |
| 16 | 0.97 ms | 16,412 |
| 32 | 2.1 ms | 15,033 |
Scale projection: 100,000 structures, one training epoch
These are projections, extrapolated from the measured per-structure timings above - not end-to-end measurements at 100k scale.
| Operation | Traditional pipeline | ProteinTensor | Speedup |
|---|---|---|---|
| Structure load (parse mmCIF each epoch) | 3.8 hours | 6 min | 37x |
| Backbone-only load (template search) | 3.8 hours | 2 min | 95x |
| Full feature assembly (seq + MSA + pairs + emb) | 16 hours | 3.9 hours | 4x |
| MSA generation (JackHMMER, 32-core CPU, once) | 4,000 hours | 2.7 hours | 1,477x |
MSA generation assumes 2.4 min/protein on a 32-core server (PDB90 database, standard AlphaFold settings). ProteinTensor generates MSAs once and loads from the
.pttcache on every subsequent run. The 4,000-hour figure is the real cost AlphaFold2 and Boltz users pay to build training datasets from scratch.
Measured vs projected - read this. The 1,477x above is MSA generation (building the alignment once with JackHMMER) and is a literature-based projection, not something benchmarked here. What is measured on hardware is the recurring per-epoch MSA load - reading a cached MSA from
.pttvs re-parsing A3M text each epoch (against a vectorized A3M parser baseline): 3.4x-5.9x, growing with MSA depth. Seebenchmarks/MSA_RESULTS.md. These are different quantities; do not read the 1,477x as a measured load speedup.
Disk tradeoff
A full-featured .ptt (8,192-sequence MSA + distance matrix + ESM2-650M embedding at
float16) averages 23x larger than the source mmCIF across the six benchmark structures.
The tradeoff is deliberate: pay disk space once to avoid paying GPU-hours and CPU-hours
on every training run. A structure-only .ptt with no cached features is smaller than
the source mmCIF.
Install
pip install -e ".[dev]" # core + dev tools
pip install -e ".[cloud]" # adds fsspec, s3fs, gcsfs for remote reads
pip install -e ".[dev,cloud]" # everything
Requires Python >= 3.9, gemmi, zarr, numpy, click, rich.
Quick Start
Convert a structure
proteintensor convert 1abc.cif 1abc.ptt
proteintensor info 1abc.ptt
Convert a sequence (no structure required)
For sequence-driven predictors like AlphaFold and Boltz, the primary input is a
sequence, not a structure. ProteinTensor can build a sequence-only .ptt (no
coordinates) directly from a raw string or a FASTA file:
proteintensor convert-seq MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG ubq.ptt
proteintensor convert-seq complex.fasta complex.ptt # multi-record FASTA -> multi-chain
import proteintensor as pt
data = pt.from_sequence("MQIFVKTLTGK...", pdb_id="UBQ", chain_id="A")
data.has_structure # False - sequence-only entry
data.sequence_tokens # (N_res,) int32
pt.write(data, "ubq.ptt")
# FASTA: a single record -> one chain; multiple records -> multi-chain complex
data = pt.from_fasta("complex.fasta")
Batch-convert a directory
Convert an entire directory of structures in parallel, with progress reporting. Files that fail to parse are skipped and listed in the summary; already-converted outputs are skipped by default.
proteintensor convert-dir ./pdb_files/ ./ptt_files/ # auto worker count
proteintensor convert-dir ./pdb_files/ ./ptt_files/ --workers 16 --recursive
proteintensor convert-dir ./pdb_files/ ./ptt_files/ --overwrite # rebuild existing
Benchmark against mmCIF
proteintensor benchmark 1abc.cif --rounds 20
Cache an MSA (after running JackHMMER / ColabFold)
import proteintensor as pt
msa = pt.from_a3m("1abc_uniref90.a3m",
tool="jackhammer", tool_version="3.3.2",
database="uniref90", database_date="2024-01")
pt.add_msa("1abc.ptt", msa, source="uniref90")
Cache ESM2 embeddings (after GPU inference)
pt.add_embedding("1abc.ptt", esm_representations,
model="esm2_t33_650M_UR50D", layer=-1, dtype="float16",
sequence_hash=pt.embedding_sequence_hash(data.sequence_tokens))
Run Boltz2 directly from a .ptt file
from proteintensor import BoltzAdapter
adapter = BoltzAdapter("1abc.ptt")
predictions = adapter.predict(
"boltz_output/",
model="boltz2",
diffusion_samples=5,
recycling_steps=3,
accelerator="gpu",
)
# -> boltz_output/predictions/1abc/1abc_model_0.cif (predicted structure)
# -> boltz_output/predictions/1abc/pae_*.npz (PAE matrix)
# -> boltz_output/predictions/1abc/plddt_*.npz (per-residue confidence)
Python API
import proteintensor as pt
# ------ Structure ------
data = pt.read("1abc.ptt")
data.atom_positions.shape # (N_atoms, 3) float32
data.sequence_tokens.shape # (N_res,) int32
data.backbone_positions.shape # (N_res, 4, 3) float32 N/CA/C/O
data.bond_edge_index.shape # (2, N_edges) int32 bidirectional
# Backbone only (fastest structural load)
bb = pt.read_backbone("1abc.ptt")
bb.positions.shape # (N_res, 4, 3)
# Bond graph only
bonds = pt.read_bonds("1abc.ptt")
# ------ MSA ------
msa = pt.read_msa("1abc.ptt", source="uniref90")
msa.tokens.shape # (N_seq, N_res) int32
msa.profile.shape # (N_res, 23) float32
# ------ Pair features ------
pt.compute_and_store_distances("1abc.ptt") # Ca-Ca distance matrix
pt.compute_and_store_contacts("1abc.ptt", threshold=8.0)
dist = pt.read_pair_feature("1abc.ptt", "distance_matrix")
dist.data.shape # (N_res, N_res, 1) float32
# Store arbitrary pair tensors (template features, MSA covariance, …)
pt.add_pair_feature("1abc.ptt", my_array, name="template_pair",
symmetric=False, dtype="float16")
# ------ PLM embeddings ------
emb = pt.read_embedding("1abc.ptt", "esm2_t33_650M_UR50D")
emb.data.shape # (N_res, 1280) float32 (upcast from float16 on load)
# ------ Ligands / small molecules ------
# Capture drugs, cofactors, and ions from a structure (opt-in)
data = pt.from_mmcif("6oim.cif", include_ligands=True)
[l.name for l in data.ligands] # ['MG', 'GDP', 'MOV'] (MOV = sotorasib)
ligs = pt.read_ligands("6oim.ptt")
ligs[0].elements # (N_atoms,) S2 element symbols
ligs[0].positions # (N_atoms, 3) float32
pt.list_ligands("6oim.ptt") # ['MG', 'GDP', 'MOV']
# Build a ligand from SMILES (needs `pip install "proteintensor[ligands]"`)
aspirin = pt.from_smiles("CC(=O)Oc1ccccc1C(=O)O", name="AIN")
pt.add_ligand("target.ptt", aspirin) # attach to an existing .ptt
# ------ Lazy / zero-copy access ------
positions = pt.mmap_positions("1abc.ptt") # zarr.Array - no full load
backbone = pt.mmap_backbone("1abc.ptt") # [N_res, 4, 3]
msa_lazy = pt.mmap_msa_tokens("1abc.ptt", "uniref90") # [N_seq, N_res]
emb_lazy = pt.mmap_embedding("1abc.ptt", "esm2_t33_650M_UR50D")
# Slice without loading the full tensor
ca_window = backbone[100:164, 1, :] # 64 Ca positions
top_100 = msa_lazy[:100, :] # first 100 MSA sequences
# ------ PyTorch ------
import torch
data = pt.read("1abc.ptt")
coords = torch.from_numpy(data.atom_positions) # (N_atoms, 3)
tokens = torch.from_numpy(data.sequence_tokens) # (N_res,)
# ------ JAX ------
import jax.numpy as jnp
data = pt.read("1abc.ptt")
coords = jnp.array(data.atom_positions)
# ------ Cloud streaming ------
# Read a single structure directly from S3 (no local download)
data = pt.read("s3://my-bucket/proteins/1abc.ptt")
bb = pt.read_backbone("s3://my-bucket/proteins/1abc.ptt")
arr = pt.mmap_positions("s3://my-bucket/proteins/1abc.ptt") # lazy remote array
# Open a dataset stored in cloud
ds = pt.ProteinDataset("s3://my-bucket/training.ptt")
# Prepare a local .ptt for fast remote reads before uploading (one-time)
pt.consolidate("1abc.ptt") # writes .zmetadata
# aws s3 cp -r 1abc.ptt s3://my-bucket/proteins/1abc.ptt
# Pass storage_options for credentials or custom endpoints
data = pt.read(
"s3://my-bucket/proteins/1abc.ptt",
storage_options={"key": "ACCESS_KEY", "secret": "SECRET_KEY"},
)
# ------ Multi-structure dataset ------
# Structure .ptt files and sequence-only .ptt files can be mixed in one dataset.
pt.create_dataset("training.ptt")
for ptt_file in Path("ptt_files").glob("*.ptt"):
pt.add_to_dataset("training.ptt", ptt_file)
ds = pt.ProteinDataset("training.ptt")
len(ds) # number of structures
ds[0] # ProteinTensorData by index
ds["1ABC"] # ProteinTensorData by PDB ID (case-insensitive)
# PyTorch DataLoader - collate pads variable-length sequences
from torch.utils.data import DataLoader
loader = DataLoader(ds, batch_size=8, collate_fn=pt.ProteinDataset.collate)
for batch in loader:
coords = torch.from_numpy(batch["atom_positions"]) # (B, max_atoms, 3)
pad = torch.from_numpy(batch["padding_mask"]) # (B, max_res) True=real
has_str = torch.from_numpy(batch["has_structure"]) # (B,) False = sequence-only
Sequence-only entries contribute zero atoms to the batch (n_atoms == 0,
has_structure == False), so sequence-driven and structure-based samples can be
loaded together in one DataLoader.
.ptt file layout
structure.ptt/ Zarr directory store (v0.7)
├── .zattrs format, version, pdb_id, resolution, ...
├── sequence/
│ ├── tokens [N_res] int32 AA vocab indices (0-20)
│ ├── residue_index [N_res] int32 PDB sequence numbers
│ └── chain_id [N_res] S1 chain labels
├── atoms/
│ ├── positions [N_atoms, 3] float32 Angstrom coordinates
│ ├── mask [N_atoms] bool
│ └── b_factors [N_atoms] float32 B-factor / pLDDT
├── structure/
│ ├── residue_atom_start [N_res] int32 first atom index per residue
│ └── residue_atom_count [N_res] int32 atom count per residue
├── backbone/
│ ├── positions [N_res, 4, 3] float32 N/CA/C/O coords
│ └── mask [N_res, 4] bool False = missing atom
├── bonds/
│ ├── edge_index [2, N_edges] int32 bidirectional (src, dst)
│ └── edge_type [N_edges] uint8 1=SINGLE 2=DOUBLE 4=AROMATIC
│ 5=PEPTIDE 6=DISULFIDE
├── msa/
│ └── <source>/ one sub-group per database source
│ ├── .zattrs tool, version, database, date, seq SHA-256
│ ├── tokens [N_seq, N_res] int32 0-20=AA 21=GAP 22=MASK
│ ├── deletion_matrix [N_seq, N_res] float32 insertions before each column
│ ├── profile [N_res, 23] float32 per-position residue frequencies
│ └── deletion_mean [N_res] float32
├── pairs/
│ └── <name>/ one sub-group per named feature
│ ├── .zattrs channels, symmetric, dtype, description
│ └── data [N_res, N_res, C] any dtype, chunked 128x128xC
├── embeddings/
│ └── <model>/ one sub-group per PLM model
│ ├── .zattrs model, layer, dim, dtype, seq SHA-256
│ └── data [N_res, D] float32 or float16, chunked 256xD
└── ligands/
└── <index>/ one sub-group per non-polymer ligand
├── .zattrs name (CCD), chain_id, res_num, smiles
├── elements [N_atoms] S2 element symbols
├── positions [N_atoms, 3] float32 Angstrom coordinates
└── b_factors [N_atoms] float32
Multi-structure dataset layout
dataset.ptt/ Zarr directory store
├── .zattrs format="proteintensor-dataset", version, num_structures
└── structures/
├── 000000/ zero-padded integer key
│ └── (same layout as single .ptt above)
├── 000001/
│ └── ...
└── ...
Each sub-group under structures/ is identical to a standalone .ptt root, so all single-structure reader helpers work on sliced groups.
Supported models
| Model | Adapter | Status |
|---|---|---|
| Boltz 2 | BoltzAdapter |
Verified - end-to-end prediction on RTX 5080 |
| Boltz 1 | BoltzAdapter(model="boltz1") |
Supported |
| OpenFold | - | Planned |
| RoseTTAFold-All-Atom | - | Planned |
| Chai-1 | - | Planned |
Run tests
pytest tests/ -v
150 tests across structure roundtrip, backbone/bonds/MSA/pairs/embeddings/ligands, sequence conversion, A3M parsing, Boltz adapter, multi-structure dataset, and cloud streaming (memory:// fsspec - no real cloud account required).
Roadmap
- Backbone-only dense layout
[N_res, 4, 3]for faster backbone access - Bond graph storage (
edge_index) - SINGLE / DOUBLE / AROMATIC / PEPTIDE / DISULFIDE - MSA feature caching - A3M parser, provenance tracking, multi-source per file
- Pair representation block
[N, N, C]- distance matrix, contact map, generic named tensors - Pre-embedded ESM2 / ESM3 features - float16 storage, provenance hash, lazy mmap access
- Model adapters: Boltz2 - end-to-end prediction from
.pttverified on RTX 5080 - Multi-structure dataset container - one Zarr store, N structures, PyTorch DataLoader compatible
- Cloud streaming - S3 / GCS via
fsspec, training directly from object storage
Model coverage
- OpenFold adapter
- RoseTTAFold-All-Atom adapter
- Chai-1 adapter
Data pipeline
- Batch convert CLI - convert entire PDB directories in parallel with progress reporting
- Sequence-identity dataset splitting - MMseqs2-based cluster splits to prevent data leakage between train / val / test
Format extensions
- Ligand / small-molecule support - CCD-based extraction from structures, SMILES input via RDKit, element/coordinate storage (bond graphs and binding-site annotations still to come)
- MD trajectory storage - time axis
[N_frames, N_atoms, 3]for conformational ensembles and AlphaFold 3 diffusion trajectories
Performance
- Parallel DataLoader workers - thread-safe multi-worker prefetching verified under PyTorch DDP
- Format version migration CLI - upgrade .ptt files in-place across version bumps
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file proteintensor-0.3.0.tar.gz.
File metadata
- Download URL: proteintensor-0.3.0.tar.gz
- Upload date:
- Size: 67.2 kB
- Tags: Source
- Uploaded using Trusted Publishing? Yes
- Uploaded via: twine/6.1.0 CPython/3.13.12
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
6e6189d3969f28be38c49abc366094947a92e33dfc3c82db45804ae285523953
|
|
| MD5 |
58e67789f7c0f1c6a250a8e75c0e8d35
|
|
| BLAKE2b-256 |
f5787f8fb3938f6abc6cb2e141b18667b9e0291814dddca5dd0a557b1bbe8704
|
Provenance
The following attestation bundles were made for proteintensor-0.3.0.tar.gz:
Publisher:
publish.yml on mooreneural/HelixDB
-
Statement:
-
Statement type:
https://in-toto.io/Statement/v1 -
Predicate type:
https://docs.pypi.org/attestations/publish/v1 -
Subject name:
proteintensor-0.3.0.tar.gz -
Subject digest:
6e6189d3969f28be38c49abc366094947a92e33dfc3c82db45804ae285523953 - Sigstore transparency entry: 2052919358
- Sigstore integration time:
-
Permalink:
mooreneural/HelixDB@36629b2640e88ad609eb7401c28320cc07b32825 -
Branch / Tag:
refs/tags/v0.3.0 - Owner: https://github.com/mooreneural
-
Access:
public
-
Token Issuer:
https://token.actions.githubusercontent.com -
Runner Environment:
github-hosted -
Publication workflow:
publish.yml@36629b2640e88ad609eb7401c28320cc07b32825 -
Trigger Event:
release
-
Statement type:
File details
Details for the file proteintensor-0.3.0-py3-none-any.whl.
File metadata
- Download URL: proteintensor-0.3.0-py3-none-any.whl
- Upload date:
- Size: 49.2 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? Yes
- Uploaded via: twine/6.1.0 CPython/3.13.12
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
c4f8c64417ce74a1454a2863e70f7165f5337ffc51fed38353c3d3db1f86f54d
|
|
| MD5 |
b47dd9e5890865f439326489b034c48e
|
|
| BLAKE2b-256 |
c52e3e007cb6a035ff9830f7a9fe84995f007fdcdec4dcdfe1f25a1d29548473
|
Provenance
The following attestation bundles were made for proteintensor-0.3.0-py3-none-any.whl:
Publisher:
publish.yml on mooreneural/HelixDB
-
Statement:
-
Statement type:
https://in-toto.io/Statement/v1 -
Predicate type:
https://docs.pypi.org/attestations/publish/v1 -
Subject name:
proteintensor-0.3.0-py3-none-any.whl -
Subject digest:
c4f8c64417ce74a1454a2863e70f7165f5337ffc51fed38353c3d3db1f86f54d - Sigstore transparency entry: 2052919683
- Sigstore integration time:
-
Permalink:
mooreneural/HelixDB@36629b2640e88ad609eb7401c28320cc07b32825 -
Branch / Tag:
refs/tags/v0.3.0 - Owner: https://github.com/mooreneural
-
Access:
public
-
Token Issuer:
https://token.actions.githubusercontent.com -
Runner Environment:
github-hosted -
Publication workflow:
publish.yml@36629b2640e88ad609eb7401c28320cc07b32825 -
Trigger Event:
release
-
Statement type: