Skip to main content

Protein structure prediction in PyMOL

Project description

PymolFold

Inspired by ColabFold by Sergey O.
Visualization inspired by pymol-color-alphafold.
Thanks to ESMFold by Meta and the API.
Fast access to AlphaMissense predicted Human proteins provided by hegelab.

Quick Start Guide

1. Install PyMOL

This project enables structure and domain prediction directly within the PyMOL visualization software.

SO, download and install PyMOL from the official website.


2. Obtain API Tokens

PymolFold utilizes APIs from ESM3 and NVIDIA Boltz2.
You need to obtain API tokens from both:

After obtaining your tokens, set them as environment variables:

  • ESM_API_TOKEN
  • NVCF_API_KEY
    Both must be uppercase and contain underscores.

How to set environment variables:

Windows:

  1. Press Win + S and search for "Environment Variables".
  2. Select "Edit the system environment variables".
  3. In the System Properties window, go to "Advanced" → "Environment Variables".
  4. Add or edit variables in "System variables" or "User variables".
    • Example:
      • Variable name: MY_ENV
      • Variable value: hello
  5. (Windows User pay attention): In case of some strange error occurs, you also need set an extra variables PYTHONUTF8 and value set to 1.
  6. Save and close.

Mac:

  1. Press Command + Space, type "terminal", and open Terminal.
  2. Edit your shell config:
    vim ~/.zshrc
    
  3. Add your variable (example, replace with your actual token):
    export MY_ENV=hello
    
  4. Save and exit Vim. (Ask ChatGPT if you duno how to do this)
  5. Activate the environment variable:
    source ~/.zshrc
    

3. Run the Plugin

Once PyMOL and your API tokens are ready, download the run_plugin.py file from this project.
Open PyMOL and enter the full path to run_plugin.py:

run path_to/run_plugin.py

If you see the following, installation was successful:


4. How to Use

PymolFold provides several features: esm3, boltz2, and color_plddt.

1. Predict Monomer Protein Structure

Use the convenient esm3 command:

esm3 sequence [, name]
# Example:
esm3 MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG

2. Predict Complexes, DNA, RNA, or Ligand Structures

For more complex predictions, use the boltz2 command.
Due to the number of required inputs, a web interface is provided (inspired by NVIDIA Boltz2).
Currently, conditional prediction is not supported, but may be added in the future.

To launch the web interface, enter the following in the PyMOL command line:

boltz2

You can run the provided example:

When using CCD code, you can check all the existed CCDs under pymolfold/gui/ccd_keys.json

After clicking Run on the web page, wait about 6 seconds (depending on protein size), and the structure will appear in PyMOL!


3. View pLDDT Scores

After prediction, enter the following to view pLDDT scores for the predicted structure:

color_plddt

4. How to evaluate the predicted results?

We utilized PXMeter to evaluate the differences between predicted structures and reference structures. PXMeter(0.1.4) now only supports PPI analysis, and more details can be seen in their repo. But unfortunately, we copied the repo and refine it since the python version may conflict with the one of PyMOL.

But how to use in PyMolFold?

pxmeter_align full_path_to/real_struct.cif,full_path_to/predict_struct.cif 

Windows users PAY ATTENTION, make sure there is no double quotes around the path.

It takes around 20s to loading when you first time using this method.

Unfortunately (again), we haven't fix out how to get the structure path from pymol object, so you guys have to manually provide them. Besides, only cif format is supported now.

After running the script above, you will get the metrics in csv and png format under the folder you setted (if not set, it will generate in the root path). You can use the exmaple files under pymolfold/example/, and the results should be exactly the same as pymolfold/example/metrics.

Others

Version Current version is 0.2.4, and if you are interesting in the source code, you can install pymolfold directly by pip install pymolfold==0.2.4.

Info
The PymolFold service is running on a A5000 instance (cost $100 a week), and the sequence length is limited to 1000aa.

Issues and Errors
If you encounter any errors or issues while using this project, please don't hesitate to open an issue here on GitHub. Your feedback helps us improve the project and make it more user-friendly for everyone.

PymolFold Server: A Shared Resource
Please note that the PymolFold server is a shared resource, and I request you to use it responsibly. Do not abuse the server, as it can affect the availability and performance of the service for other users.

21Sept2025: Refactor PyMOLFold, deleting unrelated module, adding boltz2 using NVIDIA API
17Jan2025: Add `esm3` to use ESM-3 for folding.
21Aug2023: As the ESMFold API is not stable, the job will be sent to PymolFold server if the job failed.
11Apr2023: `pf_plugin.py` is the PyMOL plugin and the `pf_pkg.py` is a pymol-free python package.

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

pymolfold-0.2.4.tar.gz (131.7 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

pymolfold-0.2.4-py3-none-any.whl (124.8 kB view details)

Uploaded Python 3

File details

Details for the file pymolfold-0.2.4.tar.gz.

File metadata

  • Download URL: pymolfold-0.2.4.tar.gz
  • Upload date:
  • Size: 131.7 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/6.2.0 CPython/3.12.5

File hashes

Hashes for pymolfold-0.2.4.tar.gz
Algorithm Hash digest
SHA256 eb3404771e81f1888ea355177d1c43a6f63e3e68fc99f670a4a11fac2545ad85
MD5 c330fff055ced79c339e16293377fa9d
BLAKE2b-256 8b56a9f2384f63f9cf4c909e21fd7eafd3546a6f7f8ffd581e15c5774fe4a57a

See more details on using hashes here.

File details

Details for the file pymolfold-0.2.4-py3-none-any.whl.

File metadata

  • Download URL: pymolfold-0.2.4-py3-none-any.whl
  • Upload date:
  • Size: 124.8 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/6.2.0 CPython/3.12.5

File hashes

Hashes for pymolfold-0.2.4-py3-none-any.whl
Algorithm Hash digest
SHA256 bde2fc825005f9c86107b73c96a6d096f9b539f65c84b8a9ee50d43cc4486fcc
MD5 7467fca1759db348a7414b838dd1c5f0
BLAKE2b-256 2c00432b1656dd9591fa3597c1deeab643004e3cc7b323c873fb8a61d65f0835

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page