pymolfold 0.2.7

Protein structure prediction in PyMOL

PymolFold

Inspired by ColabFold by Sergey O.
Visualization inspired by pymol-color-alphafold.
Thanks to ESMFold by Meta and the API.
Fast access to AlphaMissense predicted Human proteins provided by hegelab.

Quick Start Guide

1. Install PyMOL

This project enables structure and domain prediction directly within the PyMOL visualization software.

SO, download and install PyMOL from the official website.

---

2. Run the Plugin

You can directly run the following command in >PyMOL

run https://raw.githubusercontent.com/ivandon15/PymolFold/main/run_plugin.py

If you see the following, installation was successful:

---

3. Obtain API Tokens

PymolFold utilizes APIs from ESM3 and NVIDIA Boltz2.
You need to obtain API tokens from both:

• ESM3 API
• NVIDIA Boltz2

After obtaining your tokens, set them as environment variables:

• ESM_API_TOKEN
• NVCF_API_KEY
  Both must be uppercase and contain underscores.

How to set environment variables: Again, in >PyMOL, you can execute following command step by step

import os
print(os.environ["ESM_API_TOKEN"])
print(os.environ["NVCF_API_KEY"]) # if error occurs, it means you haven't set the key right

set_api_key ESM_API_TOKEN [, your_esm_api_key]
set_api_key NVCF_API_KEY [, your_nvcf_api_key]

print(os.environ["ESM_API_TOKEN"]) # it should print out what you just set
print(os.environ["NVCF_API_KEY"])

---

4. How to Use

PymolFold provides several features: esm3, boltz2, color_plddt and pxmeter_align.

1. Predict Monomer Protein Structure

Use the convenient esm3 command:

esm3 sequence [, name]
# Example:
esm3 MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG

---

2. Predict Complexes, DNA, RNA, or Ligand Structures

For more complex predictions, use the boltz2 command.
Due to the number of required inputs, a web interface is provided (inspired by NVIDIA Boltz2).
Currently, conditional prediction is not supported, but may be added in the future.

To launch the web interface, enter the following in the PyMOL command line:

boltz2

You can run the provided example:

When using CCD code, you can check all the existed CCDs under pymolfold/gui/ccd_keys.json

After clicking Run on the web page, wait about 6 seconds (depending on protein size), and the structure will appear in PyMOL!

---

3. View pLDDT Scores

After prediction, enter the following to view pLDDT scores for the predicted structure:

color_plddt

4. How to evaluate the predicted results?

We utilized PXMeter to evaluate the differences between predicted structures and reference structures. PXMeter(0.1.4) now only supports PPI analysis, and more details can be seen in their repo. But unfortunately, we copied the repo and refine it since the python version may conflict with the one of PyMOL.

But how to use in PyMolFold?

pxmeter_align obj_real_structure_name, obj_pred_structure_name

It takes around 20s to loading when you first time using this method.

After running the script above, you will get the metrics in csv and png format under the folder you setted (if not set, it will generate in the root path). You can use the exmaple files under pymolfold/example/, and the results should be exactly the same as pymolfold/example/metrics.

Others

Version Current version is 0.2.7, and if you are interesting in the source code, you can install pymolfold directly by pip install pymolfold==0.2.7.

Info
The PymolFold service is running on a A5000 instance (cost $100 a week), and the sequence length is limited to 1000aa.

Issues and Errors
If you encounter any errors or issues while using this project, please don't hesitate to open an issue here on GitHub. Your feedback helps us improve the project and make it more user-friendly for everyone.

PymolFold Server: A Shared Resource
Please note that the PymolFold server is a shared resource, and I request you to use it responsibly. Do not abuse the server, as it can affect the availability and performance of the service for other users.

21Sept2025: Refactor PyMOLFold, deleting unrelated module, adding boltz2 using NVIDIA API
17Jan2025: Add `esm3` to use ESM-3 for folding.
21Aug2023: As the ESMFold API is not stable, the job will be sent to PymolFold server if the job failed.
11Apr2023: `pf_plugin.py` is the PyMOL plugin and the `pf_pkg.py` is a pymol-free python package.