Python bindings around the TM-align code for structural alignment of proteins
Project description
TM-Tools
Python bindings for the TM-align algorithm and code developed by Zhang et al for protein structure comparison.
Installation
From the console, simply run
pip install git+https://github.com/jvkersch/tmtools.git#egg=tmtools
The package supports Python 3.6 and up. You will need a fairly recent version of pip, as well as a C++ compiler that supports C++ 14.
This package supports Linux, macOS, and Windows.
Usage
The function tmtools.tm_align
takes two NumPy arrays with coordinates for the
residues (with shape (N, 3)
) and two sequences of peptide codes, performs the
alignment, and returns the optimal rotation matrix and translation, along with
the TM score:
>>> import numpy as np >>> from tmtools import tm_align >>> >>> coords1 = np.array( ... [[1.2, 3.4, 1.5], ... [4.0, 2.8, 3.7], ... [1.2, 4.2, 4.3], ... [0.0, 1.0, 2.0]]) >>> coords2 = np.array( ... [[2.3, 7.4, 1.5], ... [4.0, 2.9, -1.7], ... [1.2, 4.2, 4.3]]) >>> >>> seq1 = "AYLP" >>> seq2 = "ARN" >>> >>> res = tm_align(coords1, coords2, seq1, seq2) >>> res.t array([ 2.94676159, 5.55265245, -1.75151383]) >>> res.u array([[ 0.40393231, 0.04161396, -0.91384187], [-0.59535733, 0.77040999, -0.22807475], [ 0.69454181, 0.63618922, 0.33596866]]) >>> res.tm_norm_chain1 0.3105833326322145 >>> res.tm_norm_chain2 0.414111110176286
If you already have some PDB files, you can use the functions from tmalign.io
to retrieve the coordinate and sequence data:
>>> from tmtools.io import get_structure, get_residue_data >>> from tmtools.testing import get_pdb_path >>> s = get_structure(get_pdb_path("2gtl")) >>> s <Structure id=2gtl> >>> chain = next(s.get_chains()) >>> coords, seq = get_residue_data(chain) >>> seq 'DCCSYEDRREIRHIWDDVWSSSFTDRRVAIVRAVFDDLFKHYPTSKALFERVKIDEPESGEFKSHLVRVANGLKLLINLLDDTLVLQSHLGHLADQHIQRKGVTKEYFRGIGEAFARVLPQVLSCFNVDAWNRCFHRLVARIAKDLP' >>> coords.shape (147, 3)
These functions are light-weight wrappers around BioPython.
Credits
This package arose out of a personal desire to better understand both the TM-score algorithm and the pybind11 library to interface with C++ code. At this point in time it contains no original research code.
If you use the package for research, you should cite the original TM-score papers:
- Y. Zhang, J. Skolnick, Scoring function for automated assessment of protein structure template quality, Proteins, 57: 702-710 (2004).
- J. Xu, Y. Zhang, How significant is a protein structure similarity with TM-score=0.5? Bioinformatics, 26, 889-895 (2010).
License
The original TM-align software (version 20210224, released under the MIT
license) is bundled with this repository (src/extern/TMalign.cpp
). Some small
tweaks had to be made to compile the code on macOS and to embed it as a
library. This modifications are also released under the MIT license.
The rest of the codebase is released under the GPL v3 license.
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Built Distributions
Hashes for tmtools-0.0.2-cp310-cp310-win_amd64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | b61150e03d472feb4f6ed6c30532d454db48468edb09b86787b56180043ec11b |
|
MD5 | bbbb4e8ce63a00f61a37235e62b414b5 |
|
BLAKE2-256 | 8b27c40cb2e963ac5e611a89014e20018d6e1b2b754275015112eabbba4d4026 |
Hashes for tmtools-0.0.2-cp310-cp310-win32.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | bd2160a60e93ab1de8c40ca0608cf92b02624bbdceeb29e87b631a46dad31fd9 |
|
MD5 | 178a9a5ab9853d784738ae7efcaace09 |
|
BLAKE2-256 | 8c9b7cd734beeba95075744e566d7f2ef0ccbb15cf8325fba9a84afb38a423b9 |
Hashes for tmtools-0.0.2-cp310-cp310-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 713d975b67d37cd5deff1c4d9f0bbd5a1884ca7b0d60f98e1b74e8252071af3a |
|
MD5 | ab2573c44e18eb69038c238f6ab7ab7f |
|
BLAKE2-256 | 6c415e6458bfde1318723d9106d17e6dda7c135b59ea7ff8cf7fa4a5c4a598e1 |
Hashes for tmtools-0.0.2-cp310-cp310-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 81fdbeb86a856dd5c644a1db261b30e2a413b08c52d593393d1ddf38ca7b1d18 |
|
MD5 | c36369ad7a68e0e9a2994ae68b509980 |
|
BLAKE2-256 | c89e7b7a22e19fe30daedb632605739f76f6cf2fd8ade768aa94b764635c0af9 |
Hashes for tmtools-0.0.2-cp39-cp39-win_amd64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 5e313d9971addbb62d77bac0b0fa3c75433cf8f7b998e70510f06dae28c08e56 |
|
MD5 | bb737c2bff57936548d5a6bb647e0cd5 |
|
BLAKE2-256 | 90336b0a3d4befe126530ad659935c0560eccb02f00dace8fadd47e0967f9fe7 |
Hashes for tmtools-0.0.2-cp39-cp39-win32.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 7b95119e434c85484c75d77dabddb557f8a6f7b5c02e4b2da97f9634ea87326d |
|
MD5 | cdce521c8c9b49c51318f762b0ae5f15 |
|
BLAKE2-256 | 4e4ef25b0a3a19ef3b795ee8edfd2337b387fcd07b531b522ad75e7e92b703b1 |
Hashes for tmtools-0.0.2-cp39-cp39-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 7d689bc90a3ad2c0e7b2902401ba0f91775457b8767294590920b2b1e8166e4e |
|
MD5 | 67d7c9ad6ff67434d4ec50b5f14d19ca |
|
BLAKE2-256 | cb6b7b43dcceac4f628f9982d60f9768679d4de5f8ef7ecb5bcc9dfdd0b9059c |
Hashes for tmtools-0.0.2-cp39-cp39-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 015e3a0cf63915d93b2f1ab7a785da712b8f3ff2a17d49798a3bf93e64d6cd0d |
|
MD5 | 572af17e6df6dbd01db52e26df834a02 |
|
BLAKE2-256 | de0dc06e8e6b3d278366563b726665fb6b6866d0d2c1814d42b438148c899bb0 |
Hashes for tmtools-0.0.2-cp39-cp39-macosx_11_0_arm64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | f797edb854e3c1366124c89942df82452c5a73c988fbc516a563fbfd1bd696e7 |
|
MD5 | 1828d23918b37fab19b804db8027b6f7 |
|
BLAKE2-256 | bfce4ee21d4514a705cb29731d0baea1c73392ffe5176c465b0ae06176f06a68 |
Hashes for tmtools-0.0.2-cp39-cp39-macosx_10_9_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 9ae51bebaf155749abfa992d031124d8c835b4eef143d1c706676038a02fed9e |
|
MD5 | f2166ddea37665fce298f2cf5f530927 |
|
BLAKE2-256 | e85c2cbfa9f8dcba7fcf5bb4d58cd37fde43b6b008139f51e02dcc42074c9a31 |
Hashes for tmtools-0.0.2-cp38-cp38-win_amd64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 1b7ba3ac284e0d0079be291ee5b3ca72c09b689135b9c7282b135e5850d59d76 |
|
MD5 | 0485c1bbf40dd14cbbd726522e9997df |
|
BLAKE2-256 | fcfd3457baf9a960447805f731c6474a350f0962c57358eb67e681afc43d6405 |
Hashes for tmtools-0.0.2-cp38-cp38-win32.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | cc4b371a681b0083918949a648f97871e9cc658deda4dda5040dc5ade9acf0ed |
|
MD5 | 197a8e4ee564ca904e369ac3a23d05a7 |
|
BLAKE2-256 | 83d7a25afd5c760882f22c830fbe370d2cadb2a78613a21edccb351f309f5308 |
Hashes for tmtools-0.0.2-cp38-cp38-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 053a5b744278bc0ad14cefd6b88f30f50b6e5b6c933239b61d2ac38691322291 |
|
MD5 | e114166eccb6861d295e3876639c2312 |
|
BLAKE2-256 | 7e4f54ef0487636f348bad51d3f1fc56a44df283c47710da1d3139b35fa614f8 |
Hashes for tmtools-0.0.2-cp38-cp38-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 801d801a3860f416d71ee17da8c856798c255de9c9710a585a6bb51458ee5980 |
|
MD5 | 128b239e860c610768ebfc420d58a80d |
|
BLAKE2-256 | fc850df54f094e19aac335db9c2f6891f3077fba1acab501eee8e7c9925f6288 |
Hashes for tmtools-0.0.2-cp38-cp38-macosx_11_0_arm64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | a7430964b28d718b2d72d31b14fdfa800b23183be05a920fc96604a5bad75842 |
|
MD5 | 1ccefc11fcd6a4f31e6a0264eb1f8936 |
|
BLAKE2-256 | 63a3505dcf3cf51fb62c37318174e5cc8129f57c9f0ef51e5bf4a9dd0cf53c94 |
Hashes for tmtools-0.0.2-cp38-cp38-macosx_10_9_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 8de97f4b444f4e23be2810f0e46453fd8a39bc3a34606c97400b55f4fa5db71a |
|
MD5 | 3874eb59ce2db12719d7bb10358e91d6 |
|
BLAKE2-256 | 69328fe0e8ce2ca41e07a63de45d3cde0863dc5c6452df4b6241466fd1f45458 |
Hashes for tmtools-0.0.2-cp37-cp37m-win_amd64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 1d4dd54bc04d6faf725df4dcb6acb9def5a56c0e781b7f8799154131f4b3815c |
|
MD5 | 74db25d638c23a7dbe72afcef7a9bb3c |
|
BLAKE2-256 | 50aa2a9ba90551e1bcd53e80bd56f01a12b53affd4f2e69851a94729695e2c40 |
Hashes for tmtools-0.0.2-cp37-cp37m-win32.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | b615babdeb6b96495c5e42e34bf2bacdc34aba45d56f1b8a740c84843d5755f3 |
|
MD5 | f0eab9b9377bdbb503d4c4d6c0f8b3c3 |
|
BLAKE2-256 | 8eb7eb765674ec64f17633dd7e15c4a15bd9f87877eb1f444c4d95012d3350f2 |
Hashes for tmtools-0.0.2-cp37-cp37m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | e420900c6786b4e76cef9861f3e62fc5bc1966f610d4b9f9fe0ff7d1e8bce5cb |
|
MD5 | bf8b002825b5518ad17666f9ffbea00b |
|
BLAKE2-256 | 393f7745c319c3bdb000273a52a79397fdf8fa99a297a533fb9d9e50dbf32165 |
Hashes for tmtools-0.0.2-cp37-cp37m-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | bff3aaeb51d7e7b3618c87df2b84db9dce39e4cbaa359ef6ec00ecc0eadf34c2 |
|
MD5 | a71d7586321a5ebc3529a432a8aa5aa2 |
|
BLAKE2-256 | 24130724f1f27a6a2c8b0b6129eb9cb6df2c3151d07ffe1f519696dfff2d6411 |
Hashes for tmtools-0.0.2-cp37-cp37m-macosx_10_9_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | b05648946aceb667f64ded01ac0b604712fd238969eceb8aa353373ce36635f1 |
|
MD5 | c4de5fe61b52422402d0e7ad4e993d01 |
|
BLAKE2-256 | 0a4b894cb10fc539daf7916e4001d4aa5b8c6612db06e9a913e509915b7bc646 |
Hashes for tmtools-0.0.2-cp36-cp36m-win_amd64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | a236f485447248f31a7869ae322936cf0477bb96063c899ce30b0f822845641c |
|
MD5 | b926b7bb63d778f6729ca0d1d06756a1 |
|
BLAKE2-256 | a2ac0c26a6b6af9acf8c2e43564f970b54b2d3a075185fb4574b8ec7a6b507de |
Hashes for tmtools-0.0.2-cp36-cp36m-win32.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | eb255a8f32f6dea5376838d606418d5562579836b3443d1827039f1d6d137eaf |
|
MD5 | 155425e47461fd3afe921ec80149f249 |
|
BLAKE2-256 | 591e9dfe97291ee288b72d39952129e6091738b2a7a4e0d1599102571eaeb1ae |
Hashes for tmtools-0.0.2-cp36-cp36m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 07b9e16fe21107c3c17bef302f7b2894ac5f28e0103f4da5dba0bd0d796f1851 |
|
MD5 | 169811d872f101cc7c9e058f71e329c4 |
|
BLAKE2-256 | 9385b6b1b5df0d5362dc7c20bbae9e9837ea15cab67bed7d5135909c05917cc3 |
Hashes for tmtools-0.0.2-cp36-cp36m-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 4d7aa8ba54a45a7f97416ce037c9fb16e91f1d22579a8ac0939990c5e30a156b |
|
MD5 | b785a7e43497cda79dba0a14528eac60 |
|
BLAKE2-256 | f707e2b8637f96125bd5c1e25a20d0e1bb8af12b67bd407b20d178f13c97cd25 |
Hashes for tmtools-0.0.2-cp36-cp36m-macosx_10_9_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 32877b135269be5769a1ac68f1a20997251c0134acf1bf43b0ae70493b99960d |
|
MD5 | bcb34a1049430ed7e53feb116cde161b |
|
BLAKE2-256 | 2d4b65ecfd40dc7ae532792c6952af9b967a5255f838cf440d68fbe2ffa9c734 |