Skip to main content

Python bindings around the TM-align code for structural alignment of proteins

Project description

['TM-Tools\n', '========\n', '\n', 'Python bindings for the TM-align algorithm and code developed by Zhang et\n', 'al for protein structure comparison.\n', '\n', '\n', 'Installation\n', '------------\n', '\n', 'From the console, simply run\n', 'console\n', ' pip install git+https://github.com/jvkersch/tmtools.git#egg=tmtools\n', '\n', '\n', 'The package supports Python 3.6 and up. You will need a fairly recent version\n', 'of pip, as well as a C++ compiler that supports C++ 14.\n', '\n', 'This package supports Linux, macOS, and Windows.\n', '\n', 'Usage\n', '-----\n', '\n', 'The function tmtools.tm_align takes two NumPy arrays with coordinates for the\n', 'residues (with shape (N, 3)) and two sequences of peptide codes, performs the\n', 'alignment, and returns the optimal rotation matrix and translation, along with\n', 'the TM score:\n', 'python\n', '>>> import numpy as np\n', '>>> from tmtools import tm_align\n', '>>>\n', '>>> coords1 = np.array(\n', '... [[1.2, 3.4, 1.5],\n', '... [4.0, 2.8, 3.7],\n', '... [1.2, 4.2, 4.3],\n', '... [0.0, 1.0, 2.0]])\n', '>>> coords2 = np.array(\n', '... [[2.3, 7.4, 1.5],\n', '... [4.0, 2.9, -1.7],\n', '... [1.2, 4.2, 4.3]])\n', '>>>\n', '>>> seq1 = "AYLP"\n', '>>> seq2 = "ARN"\n', '>>>\n', '>>> res = tm_align(coords1, coords2, seq1, seq2)\n', '>>> res.t\n', 'array([ 2.94676159, 5.55265245, -1.75151383])\n', '>>> res.u\n', 'array([[ 0.40393231, 0.04161396, -0.91384187],\n', ' [-0.59535733, 0.77040999, -0.22807475],\n', ' [ 0.69454181, 0.63618922, 0.33596866]])\n', '>>> res.tm_norm_chain1\n', '0.3105833326322145\n', '>>> res.tm_norm_chain2\n', '0.414111110176286\n', '\n', '\n', 'If you already have some PDB files, you can use the functions from tmalign.io\n', 'to retrieve the coordinate and sequence data:\n', 'python\n', '>>> from tmtools.io import get_structure, get_residue_data\n', '>>> from tmtools.testing import get_pdb_path\n', '>>> s = get_structure(get_pdb_path("2gtl"))\n', '>>> s\n', '<Structure id=2gtl>\n', '>>> chain = next(s.get_chains())\n', '>>> coords, seq = get_residue_data(chain)\n', '>>> seq\n', "'DCCSYEDRREIRHIWDDVWSSSFTDRRVAIVRAVFDDLFKHYPTSKALFERVKIDEPESGEFKSHLVRVANGLKLLINLLDDTLVLQSHLGHLADQHIQRKGVTKEYFRGIGEAFARVLPQVLSCFNVDAWNRCFHRLVARIAKDLP'\n", '>>> coords.shape\n', '(147, 3)\n', '\n', '\n', 'These functions are light-weight wrappers around BioPython.\n', '\n', 'Credits\n', '-------\n', '\n', 'This package arose out of a personal desire to better understand both the\n', 'TM-score algorithm and the\n', 'pybind11 library to\n', 'interface with C++ code. At this point in time it contains no original research\n', 'code.\n', '\n', 'If you use the package for research, you should cite the original TM-score\n', 'papers:\n', '\n', '- Y. Zhang, J. Skolnick, Scoring function for automated assessment of protein\n', ' structure template quality, Proteins, 57: 702-710 (2004).\n', '- J. Xu, Y. Zhang, How significant is a protein structure similarity with\n', ' TM-score=0.5? Bioinformatics, 26, 889-895 (2010).\n', '\n', 'License\n', '-------\n', '\n', 'The original TM-align software (version 20210224, released under the MIT\n', 'license) is bundled with this repository (src/extern/TMalign.cpp). Some small\n', 'tweaks had to be made to compile the code on macOS and to embed it as a\n', 'library. This modifications are also released under the MIT license.\n', '\n', 'The rest of the codebase is released under the GPL v3 license.\n']

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distributions

No source distribution files available for this release.See tutorial on generating distribution archives.

Built Distributions

If you're not sure about the file name format, learn more about wheel file names.

tmtools-0.0.1-cp310-cp310-win_amd64.whl (1.5 MB view details)

Uploaded CPython 3.10Windows x86-64

tmtools-0.0.1-cp310-cp310-win32.whl (1.5 MB view details)

Uploaded CPython 3.10Windows x86

tmtools-0.0.1-cp310-cp310-manylinux_2_12_x86_64.manylinux2010_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.10manylinux: glibc 2.12+ x86-64

tmtools-0.0.1-cp310-cp310-manylinux_2_12_i686.manylinux2010_i686.whl (1.6 MB view details)

Uploaded CPython 3.10manylinux: glibc 2.12+ i686

tmtools-0.0.1-cp39-cp39-win_amd64.whl (1.5 MB view details)

Uploaded CPython 3.9Windows x86-64

tmtools-0.0.1-cp39-cp39-win32.whl (1.5 MB view details)

Uploaded CPython 3.9Windows x86

tmtools-0.0.1-cp39-cp39-manylinux_2_12_x86_64.manylinux2010_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.9manylinux: glibc 2.12+ x86-64

tmtools-0.0.1-cp39-cp39-manylinux_2_12_i686.manylinux2010_i686.whl (1.6 MB view details)

Uploaded CPython 3.9manylinux: glibc 2.12+ i686

tmtools-0.0.1-cp39-cp39-macosx_11_0_arm64.whl (1.6 MB view details)

Uploaded CPython 3.9macOS 11.0+ ARM64

tmtools-0.0.1-cp39-cp39-macosx_10_9_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.9macOS 10.9+ x86-64

tmtools-0.0.1-cp38-cp38-win_amd64.whl (1.5 MB view details)

Uploaded CPython 3.8Windows x86-64

tmtools-0.0.1-cp38-cp38-win32.whl (1.5 MB view details)

Uploaded CPython 3.8Windows x86

tmtools-0.0.1-cp38-cp38-manylinux_2_12_x86_64.manylinux2010_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.8manylinux: glibc 2.12+ x86-64

tmtools-0.0.1-cp38-cp38-manylinux_2_12_i686.manylinux2010_i686.whl (1.6 MB view details)

Uploaded CPython 3.8manylinux: glibc 2.12+ i686

tmtools-0.0.1-cp38-cp38-macosx_11_0_arm64.whl (1.6 MB view details)

Uploaded CPython 3.8macOS 11.0+ ARM64

tmtools-0.0.1-cp38-cp38-macosx_10_9_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.8macOS 10.9+ x86-64

tmtools-0.0.1-cp37-cp37m-win_amd64.whl (1.5 MB view details)

Uploaded CPython 3.7mWindows x86-64

tmtools-0.0.1-cp37-cp37m-win32.whl (1.5 MB view details)

Uploaded CPython 3.7mWindows x86

tmtools-0.0.1-cp37-cp37m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.7mmanylinux: glibc 2.12+ x86-64

tmtools-0.0.1-cp37-cp37m-manylinux_2_12_i686.manylinux2010_i686.whl (1.6 MB view details)

Uploaded CPython 3.7mmanylinux: glibc 2.12+ i686

tmtools-0.0.1-cp37-cp37m-macosx_10_9_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.7mmacOS 10.9+ x86-64

tmtools-0.0.1-cp36-cp36m-win_amd64.whl (1.5 MB view details)

Uploaded CPython 3.6mWindows x86-64

tmtools-0.0.1-cp36-cp36m-win32.whl (1.5 MB view details)

Uploaded CPython 3.6mWindows x86

tmtools-0.0.1-cp36-cp36m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.6mmanylinux: glibc 2.12+ x86-64

tmtools-0.0.1-cp36-cp36m-manylinux_2_12_i686.manylinux2010_i686.whl (1.6 MB view details)

Uploaded CPython 3.6mmanylinux: glibc 2.12+ i686

tmtools-0.0.1-cp36-cp36m-macosx_10_9_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.6mmacOS 10.9+ x86-64

File details

Details for the file tmtools-0.0.1-cp310-cp310-win_amd64.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp310-cp310-win_amd64.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.10, Windows x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp310-cp310-win_amd64.whl
Algorithm Hash digest
SHA256 196d92cf0c7498516baa4c60899f6b7fabf1348d703c1c9119e3bd2bf9a39f34
MD5 fd254cad4aec513090379c1b43db5f02
BLAKE2b-256 34a7c4b4d335ffee4cecae2ed3836868792c1a841661ac7b5f1da72a70761fcd

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp310-cp310-win32.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp310-cp310-win32.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.10, Windows x86
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp310-cp310-win32.whl
Algorithm Hash digest
SHA256 c7a0f539f848531a213db0938af5d705e611eed79c8e285c1f1c2de4d78c5b1d
MD5 50c09ef340f672911036f28a77f388d8
BLAKE2b-256 45a85dfd406075c3730fa2f719e2fcf223c4c8e6b295fec27761a0ea760e9237

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp310-cp310-manylinux_2_12_x86_64.manylinux2010_x86_64.whl.

File metadata

File hashes

Hashes for tmtools-0.0.1-cp310-cp310-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm Hash digest
SHA256 8c5c60f271f4e655c299983e7b4bc8bc09e35d5d0f7051e15cebb0ee3e9b8c70
MD5 926fea45c98036701dda0276fbce8f12
BLAKE2b-256 7be85c574954f8248cffb3be9470369b605a1f472a23967992e189f7ad04a145

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp310-cp310-manylinux_2_12_i686.manylinux2010_i686.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp310-cp310-manylinux_2_12_i686.manylinux2010_i686.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.10, manylinux: glibc 2.12+ i686
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp310-cp310-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm Hash digest
SHA256 9a65715db75bdbc55cc88ad60f18bb2b04d3ade017080c2cd5564fd872944864
MD5 82e82bc20c5ac19db9f8344257753407
BLAKE2b-256 477c15f44c0ad8a294678fdb042bc96742cb6fbef6e6f6cfb00cb9ae620582f6

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp39-cp39-win_amd64.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp39-cp39-win_amd64.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.9, Windows x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp39-cp39-win_amd64.whl
Algorithm Hash digest
SHA256 9b8f732fb10930961356be31c7b34f77d045d63c9cf21416aa803d9ed04885c7
MD5 6cfc1defc796f6146fcc8fead34fde74
BLAKE2b-256 90674e83232dc51883122da1f85ec8ce3a2b9977f3a4eb25c91b58fe086c9758

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp39-cp39-win32.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp39-cp39-win32.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.9, Windows x86
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp39-cp39-win32.whl
Algorithm Hash digest
SHA256 014d291e7ebc3f1b1687ae3fefa0863b69793238e00eb627b6288da4ba6c77fd
MD5 e4c70aee78bcd88fdfbc0eba9fa5a70d
BLAKE2b-256 af7ded13017586e0781fba747739171573fd3dcc72578014971e712c4486bc1f

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp39-cp39-manylinux_2_12_x86_64.manylinux2010_x86_64.whl.

File metadata

File hashes

Hashes for tmtools-0.0.1-cp39-cp39-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm Hash digest
SHA256 41c783f695209a315b0825c6188c8a3c972ec0663a4a6fde25b8e5c33080e56e
MD5 0ad3955346198bc5923b55f8c292e63a
BLAKE2b-256 cec770bf617e404efc8a1097b75d8e83f7fc41b902fd70ef0ae16db100f7c8f1

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp39-cp39-manylinux_2_12_i686.manylinux2010_i686.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp39-cp39-manylinux_2_12_i686.manylinux2010_i686.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.9, manylinux: glibc 2.12+ i686
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp39-cp39-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm Hash digest
SHA256 f49b9e21775ae7ab2d1d98c1a27e83fc13edbf67690e4887f10884b50086749d
MD5 93677b641562d9e2c64ff521e43f102b
BLAKE2b-256 ba6aea7b28fb766454bad589f4ada2a376af70fdd0671205ca04f2ee4d71c288

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp39-cp39-macosx_11_0_arm64.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp39-cp39-macosx_11_0_arm64.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.9, macOS 11.0+ ARM64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp39-cp39-macosx_11_0_arm64.whl
Algorithm Hash digest
SHA256 41849e2fae183e34d2dcd9189e75b8dbc9df4cb52efeb7f6e5e174db3d8ff67a
MD5 e9f2fbf7657c247cd529a23a61c782b6
BLAKE2b-256 58fce8a9efb111f6b928a207eeec4209b2c1296cb71340fbcd26476db066df54

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp39-cp39-macosx_10_9_x86_64.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp39-cp39-macosx_10_9_x86_64.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.9, macOS 10.9+ x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp39-cp39-macosx_10_9_x86_64.whl
Algorithm Hash digest
SHA256 5d7ff0c97f28804450d2ff9d2d32550a7da9371887a9ab8f4f129d52490479b1
MD5 b2098173c40eb063dc0efb613f75d4aa
BLAKE2b-256 6e34f454215b977f7b20e45e53111088bfdd64872e7f415abd38461d72ccf294

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp38-cp38-win_amd64.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp38-cp38-win_amd64.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.8, Windows x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp38-cp38-win_amd64.whl
Algorithm Hash digest
SHA256 e50f8dd6140e781e400c22e0c6d22dff30fe50717798f61e08e834f26a2715ab
MD5 608c5f8e88674151e5d8e6010f61f6c3
BLAKE2b-256 587e2c28290ecd05b87168fa6b8c86c49467cff520395fd038c9f823f9f798f8

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp38-cp38-win32.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp38-cp38-win32.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.8, Windows x86
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp38-cp38-win32.whl
Algorithm Hash digest
SHA256 caa0aea4f8ce613f6f0c3d911bff91197be862ce0d701eb2af0c6f16373481f9
MD5 7d4dbe3104e53bdcd59cc295bf9ec18b
BLAKE2b-256 d534ea95f1b95fe8740bfe5db9f75984134b748be97f3556cf5fbfa359a1a26b

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp38-cp38-manylinux_2_12_x86_64.manylinux2010_x86_64.whl.

File metadata

File hashes

Hashes for tmtools-0.0.1-cp38-cp38-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm Hash digest
SHA256 dcfd47ae220502e31d1991af5e3a98174bbc14520a3d98eac96f86570a3db8dd
MD5 d91bcda3b8896462274d2d2b35654bd7
BLAKE2b-256 4d64c66a5464a0ddf4a64822d958a1acd33a8c89b42b517596a71bec39374787

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp38-cp38-manylinux_2_12_i686.manylinux2010_i686.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp38-cp38-manylinux_2_12_i686.manylinux2010_i686.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.8, manylinux: glibc 2.12+ i686
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp38-cp38-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm Hash digest
SHA256 49c0590dc1a4e01a386fa48a3b2b70a48663facd0bc468e0afbfadf307efa64b
MD5 01a0d9fd7d9f18e48289a151c46adca5
BLAKE2b-256 db9badc2e6edfd32267dc82a7383f643eb5d4176347bd4e009c3b02ead6384aa

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp38-cp38-macosx_11_0_arm64.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp38-cp38-macosx_11_0_arm64.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.8, macOS 11.0+ ARM64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp38-cp38-macosx_11_0_arm64.whl
Algorithm Hash digest
SHA256 02b253be8e5a9cc8ddaa6255db58a929aeded3bceb2f273fb608327a23eb900e
MD5 7378c50811c7e1357f1af88ab9030691
BLAKE2b-256 68ce37516164bb665efeeb12e094cc134e46f45f77c357d99dd658b58730ac12

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp38-cp38-macosx_10_9_x86_64.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp38-cp38-macosx_10_9_x86_64.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.8, macOS 10.9+ x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp38-cp38-macosx_10_9_x86_64.whl
Algorithm Hash digest
SHA256 ad0bd68a4bdc4a8f40942b6258ae31c22ae669777900be08f48dae564ccff835
MD5 575f0f41cf5b8f87390d1f286fec4969
BLAKE2b-256 c23fa589ab773abeaccac601d2920e8a265bdfc31eebe6fc5e4a71307514a9e8

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp37-cp37m-win_amd64.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp37-cp37m-win_amd64.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.7m, Windows x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp37-cp37m-win_amd64.whl
Algorithm Hash digest
SHA256 00287afb677fdc72cd35636d70ef7099c868c908f58e5557c7d535e6e0d11162
MD5 f5d3fb2058c426f9dd9be448b35cf03f
BLAKE2b-256 223b1a9c10466278d1bcea23f290d59dc6d489bc6754c517363b597abccced30

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp37-cp37m-win32.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp37-cp37m-win32.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.7m, Windows x86
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp37-cp37m-win32.whl
Algorithm Hash digest
SHA256 a7a8309323a9bd40892ae56e096906241d6017fed9184dafc8ac662d6f45aa27
MD5 8f4691b9c03aad5471b9ebd52608e0b0
BLAKE2b-256 3397c4ee17ee712121d72e13d8d8b8c3a74b1792d0ea7ab0cf9c5f94f87e5256

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp37-cp37m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl.

File metadata

File hashes

Hashes for tmtools-0.0.1-cp37-cp37m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm Hash digest
SHA256 95c27d21df67e44f4abfdc116b7efc42287787049d04640259ad666ba590d52f
MD5 32ea515024d5a8ebb2786653196052e5
BLAKE2b-256 73f3739ed1f39e3aaa199340d4eb5ebb8e5051fb028c9e4b5c353c49f3a2ee3f

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp37-cp37m-manylinux_2_12_i686.manylinux2010_i686.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp37-cp37m-manylinux_2_12_i686.manylinux2010_i686.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.7m, manylinux: glibc 2.12+ i686
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp37-cp37m-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm Hash digest
SHA256 40b0df926ae9f1eb108a9625a4bb57926a94f60098af84b08293d4295db84f8e
MD5 ca07409614a10d1da6efd313fc68c8ae
BLAKE2b-256 63e62db2d07c72c3d126c62e125ca580f90e6f54014790690063607858608700

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp37-cp37m-macosx_10_9_x86_64.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp37-cp37m-macosx_10_9_x86_64.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.7m, macOS 10.9+ x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp37-cp37m-macosx_10_9_x86_64.whl
Algorithm Hash digest
SHA256 6b9166f68b105f9734a94ac42f8d4eb7bbf40182cdb0689ca0628bde6fdf9d7f
MD5 7d745f4bf0fdde880cc3385c421ee793
BLAKE2b-256 40b42b5afce4699856c1ee7a79caaa1ee51bb34e832c1782386284b3da5477ed

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp36-cp36m-win_amd64.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp36-cp36m-win_amd64.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.6m, Windows x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp36-cp36m-win_amd64.whl
Algorithm Hash digest
SHA256 e7fd79d18be02254a1ba3c6ea310051fde0af697b6f397d978ded98178cf368b
MD5 f7eb89fb7e747fafb3331dda8eb654de
BLAKE2b-256 6072bde1fd149968bd2a71f026b22b5e473b195d3b928f718071990732f1a1c3

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp36-cp36m-win32.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp36-cp36m-win32.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.6m, Windows x86
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp36-cp36m-win32.whl
Algorithm Hash digest
SHA256 5a8ce3ae7ed3f3c6a42e20875b815b7a8eb99cc00025d6d5a2d17e0614417e24
MD5 881dc6022984393443503bd2601f3ac5
BLAKE2b-256 7af9e58482ed654fb5b9a2723c2a603e8ec31d62864f51fa4475c4d4cc422891

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp36-cp36m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl.

File metadata

File hashes

Hashes for tmtools-0.0.1-cp36-cp36m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm Hash digest
SHA256 d6ee4e0df510652d3c104b6144f4925ca4ddf7cf48e378192b7e0fe7488ad252
MD5 6afeb1c560dbed54cb0f3768a8c85858
BLAKE2b-256 636f5325661d2dde1324ccb00fc174b8cfe5cdbc79543e18672dabf0d3c6e91e

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp36-cp36m-manylinux_2_12_i686.manylinux2010_i686.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp36-cp36m-manylinux_2_12_i686.manylinux2010_i686.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.6m, manylinux: glibc 2.12+ i686
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp36-cp36m-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm Hash digest
SHA256 aacaf83f13d38ee4705c573b02400363a476f726f81c563db2c46c3d9073d0d5
MD5 4c0d7ee2ac2c0e0a0a6ef5b65dbdaf43
BLAKE2b-256 cb35ca78957bb099c8678870d4c84c83f44fca8636655f3519b5715383de430e

See more details on using hashes here.

File details

Details for the file tmtools-0.0.1-cp36-cp36m-macosx_10_9_x86_64.whl.

File metadata

  • Download URL: tmtools-0.0.1-cp36-cp36m-macosx_10_9_x86_64.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.6m, macOS 10.9+ x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.1-cp36-cp36m-macosx_10_9_x86_64.whl
Algorithm Hash digest
SHA256 d5d07453c29ff60dd571f2385bf424476a4b536e9f3415eef55dd8174bfbe156
MD5 db5705b5da19d07e26e4a8a427c3a97d
BLAKE2b-256 e939bce126a8d0c5995daa3b21b0b52652816224cbc0bbe1f27781b780354d55

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page