PyOPA - Optimal Pairwise Alignments
This python package provides a fast implementation to compute
optimal pairwise alignments of molecular sequences
ML distance estimates of pairwise alignments.
The implementation uses Farrar’s algorithm <http://bioinformatics.oxfordjournals.org/content/23/2/156.abstract>_ to compute the optimal pairwise alignment using SSE vectorization operations. This package implements the Smith-Waterman and Needleman-Wunsch algorithm to compute the local and global sequence alignments.
Installation
You can install the package using pip:
pip install pyopaWe provide wheels for Linux, MacOS (x86_64) and (arm64) for cpython.
Example
import pyopa
log_pam1_env = pyopa.read_env_json(os.path.join(pyopa.matrix_dir(), 'logPAM1.json'))
s1 = pyopa.Sequence('GCANLVSRLENNSRLLNRDLIAVKINADVYKDPNAGALRL')
s2 = pyopa.Sequence('GCANPSTLETNSQLVNRELIAVKINPRVYKGPNLGAFRL')
# super fast check whether the alignment reaches a given min-score
min_score = 100
pam250_env = pyopa.generate_env(log_pam1_env, 250, min_score)
pyopa.align_short(s1, s2, pam250_env)1 maintainer
Metadata
1 maintainer
Release files for pyopa 0.9.0
For a detailed explanation of source distributions (sdists) and built distributions (wheels), please see the package formats documentation.
Source distribution (sdist)
| File | Size | Uploaded | Provenance | Actions |
|---|---|---|---|---|
| pyopa-0.9.0.tar.gz | 4.1 MB | With provenance | Details for pyopa-0.9.0.tar.gz |
Built distributions (wheels)
Total release size: 201.3 MB
Release files / pyopa-0.9.0.tar.gz
| Download URL | pyopa-0.9.0.tar.gz |
|---|---|
| Size | 4.1 MB |
| Tags | Source |
|
SHA-256 checksum How to use checksums |
b6690ac15c952d9df3a9ad55a9f7208e6b3153f9cde0491b3314bbf47427661e
|
|
BLAKE2b-256 checksum How to use checksums |
8382824900d6b93f3a0f7369ea11fe4b0a87bf54262635cb3757c991f34da49e
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp315-cp315-win_arm64.whl
| Download URL | pyopa-0.9.0-cp315-cp315-win_arm64.whl |
|---|---|
| Size | 3.8 MB |
| Tags | CPython 3.15 Windows ARM64 |
|
SHA-256 checksum How to use checksums |
4729a3803328009d6fd5a05efd3f227bf8a613f8a68f4fd752615d1eecf4f05c
|
|
BLAKE2b-256 checksum How to use checksums |
9f095c2f69ca9dbbfe564d31e92378713351fa6549f2dafd7002f00468e9d1e3
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp315-cp315-win_amd64.whl
| Download URL | pyopa-0.9.0-cp315-cp315-win_amd64.whl |
|---|---|
| Size | 3.7 MB |
| Tags | CPython 3.15 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
db8da808da75779afa01ffbd2d9705edf9e4a960ea8cc9035658c9eecbf6a733
|
|
BLAKE2b-256 checksum How to use checksums |
ca8b5c401bdda100cc70099108d825b905d2c07d48ca7daf85c791f2c9a9274f
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp315-cp315-musllinux_1_2_x86_64.whl
| Download URL | pyopa-0.9.0-cp315-cp315-musllinux_1_2_x86_64.whl |
|---|---|
| Size | 4.6 MB |
| Tags | CPython 3.15 Linux musl 1.2+ x86-64 |
|
SHA-256 checksum How to use checksums |
c964b66d5171b914f3a139619114d112b539011f9dd0ce4be9d34670ec08cfab
|
|
BLAKE2b-256 checksum How to use checksums |
deba6934280d3f1ad51d694e2df8c02f2fbbf03020250c667658ebce317ab056
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp315-cp315-musllinux_1_2_aarch64.whl
| Download URL | pyopa-0.9.0-cp315-cp315-musllinux_1_2_aarch64.whl |
|---|---|
| Size | 4.5 MB |
| Tags | CPython 3.15 Linux musl 1.2+ ARM64 |
|
SHA-256 checksum How to use checksums |
65de39b4e857e2ad61302ec73413b054629f07d2c452e3ddfe1119af751edfd9
|
|
BLAKE2b-256 checksum How to use checksums |
452934fac67e87d5306f52321ddecab9c707394c4279688f5d788c8bfbc457f2
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp315-cp315-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl
| Download URL | pyopa-0.9.0-cp315-cp315-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl |
|---|---|
| Size | 4.6 MB |
| Tags | CPython 3.15 Linux glibc 2.17+ x86-64 Linux glibc 2.28+ x86-64 |
|
SHA-256 checksum How to use checksums |
92f6ab147a667d426f199afe202dc0ac8ba120e9c8c4d56726d55132c1577926
|
|
BLAKE2b-256 checksum How to use checksums |
054198e6005bfc09f2b654a7a03fbb921c1e4862205f88dc78ea8a1cd5a7311b
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp315-cp315-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl
| Download URL | pyopa-0.9.0-cp315-cp315-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl |
|---|---|
| Size | 4.5 MB |
| Tags | CPython 3.15 Linux glibc 2.17+ ARM64 Linux glibc 2.28+ ARM64 |
|
SHA-256 checksum How to use checksums |
a8692199d6691bc68879a0ed3b77c5e050b138f1311a655a9f2138d535cf9551
|
|
BLAKE2b-256 checksum How to use checksums |
91b5e83988b7040f7b76fdca68360665d8c2adbfa09e142629ee5b080e4677bb
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp315-cp315-macosx_11_0_x86_64.whl
| Download URL | pyopa-0.9.0-cp315-cp315-macosx_11_0_x86_64.whl |
|---|---|
| Size | 4.0 MB |
| Tags | CPython 3.15 macOS 11.0+ x86-64 |
|
SHA-256 checksum How to use checksums |
14e157bdf889509d29355924181024ae5481866aedcac1761c0b436b360be2b6
|
|
BLAKE2b-256 checksum How to use checksums |
622c52d77d326420070516203a3be02f57efc3db0534082bad1427d0e72a13d7
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp315-cp315-macosx_11_0_arm64.whl
| Download URL | pyopa-0.9.0-cp315-cp315-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.9 MB |
| Tags | CPython 3.15 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
b027615173bcc82d1c0efaaaab0b0a6dfe68e8747a8b4bee656432d31a710720
|
|
BLAKE2b-256 checksum How to use checksums |
9825bf8526f530d81437243707e236ccd3a05863aff28852cd7291b540e6e4cd
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp314-cp314-win_arm64.whl
| Download URL | pyopa-0.9.0-cp314-cp314-win_arm64.whl |
|---|---|
| Size | 3.8 MB |
| Tags | CPython 3.14 Windows ARM64 |
|
SHA-256 checksum How to use checksums |
38a5d5496d6d5465fcedb9238a5ecbaec68f59dd717f801008c66a9375292234
|
|
BLAKE2b-256 checksum How to use checksums |
f65613975b9c85f8fd9a411ae84616e9bd667fd9c4ac589b009dfa04d1f13c45
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp314-cp314-win_amd64.whl
| Download URL | pyopa-0.9.0-cp314-cp314-win_amd64.whl |
|---|---|
| Size | 3.7 MB |
| Tags | CPython 3.14 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
17389e542257c86fff7d0de1b063fc0041bd87554ad4a7c3bb7411af7e9f3dac
|
|
BLAKE2b-256 checksum How to use checksums |
b91f2c674ad507b76163d33c7d560ba39a6663ac8f97cc3006340fb9ebc94e49
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp314-cp314-musllinux_1_2_x86_64.whl
| Download URL | pyopa-0.9.0-cp314-cp314-musllinux_1_2_x86_64.whl |
|---|---|
| Size | 4.6 MB |
| Tags | CPython 3.14 Linux musl 1.2+ x86-64 |
|
SHA-256 checksum How to use checksums |
ed82f513cf7c7603df51f9375749e22c45011af728be67e94413edf58d3185b4
|
|
BLAKE2b-256 checksum How to use checksums |
fbdc24cef28f59e64abc9c8c1d1b498f18cb5267e5220756771f6ac820b26579
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp314-cp314-musllinux_1_2_aarch64.whl
| Download URL | pyopa-0.9.0-cp314-cp314-musllinux_1_2_aarch64.whl |
|---|---|
| Size | 4.6 MB |
| Tags | CPython 3.14 Linux musl 1.2+ ARM64 |
|
SHA-256 checksum How to use checksums |
efb92f87f5a5312e288711944283b765ad862d86c176045a22ac610a236f75c9
|
|
BLAKE2b-256 checksum How to use checksums |
e37b978e811bd58d1e4e310cc0e79c6a0f3b537f7c65bcf4c8f4ff5a8dac5c9d
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl
| Download URL | pyopa-0.9.0-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl |
|---|---|
| Size | 4.6 MB |
| Tags | CPython 3.14 Linux glibc 2.17+ x86-64 Linux glibc 2.28+ x86-64 |
|
SHA-256 checksum How to use checksums |
48940cecdd3ceaed6ccf7f16966e9108ab8f8e1ca4b6b0b769303948fec3291a
|
|
BLAKE2b-256 checksum How to use checksums |
146f69aae568267eccb55d1e5eab1814d8b713ab682fa91c83648713e649bb43
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl
| Download URL | pyopa-0.9.0-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl |
|---|---|
| Size | 4.5 MB |
| Tags | CPython 3.14 Linux glibc 2.17+ ARM64 Linux glibc 2.28+ ARM64 |
|
SHA-256 checksum How to use checksums |
382e70c95b697f4a2649ac0dbcf235d9785466c3ce19e616db5694f2beef3d46
|
|
BLAKE2b-256 checksum How to use checksums |
7d22c6f61e2695e104ddb5464030f6cc91bec9772f584c23cd34eaa8dd7cade5
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp314-cp314-macosx_11_0_x86_64.whl
| Download URL | pyopa-0.9.0-cp314-cp314-macosx_11_0_x86_64.whl |
|---|---|
| Size | 4.0 MB |
| Tags | CPython 3.14 macOS 11.0+ x86-64 |
|
SHA-256 checksum How to use checksums |
0ce06a766b2250e575a6d1389df722fca65433ea89461eec446555db5c837cbb
|
|
BLAKE2b-256 checksum How to use checksums |
4ccd4ed072e54638f7fb38a8ff4913a34894e3192ab7466488481452bffd35e5
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp314-cp314-macosx_11_0_arm64.whl
| Download URL | pyopa-0.9.0-cp314-cp314-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.9 MB |
| Tags | CPython 3.14 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
c0691d0474c7b2080ff7621210cc75a86053f425eacb53108989625f8f49acaf
|
|
BLAKE2b-256 checksum How to use checksums |
9b242d4a775d47959ec3fbd9b7aaea01d0f6f7a45b5e4f26dc5989bf1890afd0
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp313-cp313-win_arm64.whl
| Download URL | pyopa-0.9.0-cp313-cp313-win_arm64.whl |
|---|---|
| Size | 3.8 MB |
| Tags | CPython 3.13 Windows ARM64 |
|
SHA-256 checksum How to use checksums |
3634002ec957a1277f20571e724812b28df687f1275b8335fed3067a46ce8467
|
|
BLAKE2b-256 checksum How to use checksums |
75c94b04d8ff13cbd3fd9d2bddbd83f0f1d89c0e4994a837dc27da33fb2b8f4a
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp313-cp313-win_amd64.whl
| Download URL | pyopa-0.9.0-cp313-cp313-win_amd64.whl |
|---|---|
| Size | 3.7 MB |
| Tags | CPython 3.13 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
216578ef42c2814da85f6090384d15a4c7f58555043fd0f11ebffebd646152e9
|
|
BLAKE2b-256 checksum How to use checksums |
42bf4dddc24d55ca2e5f0e03a80c0fd7172c01ecce0dda175a663968c905de2a
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp313-cp313-musllinux_1_2_x86_64.whl
| Download URL | pyopa-0.9.0-cp313-cp313-musllinux_1_2_x86_64.whl |
|---|---|
| Size | 4.6 MB |
| Tags | CPython 3.13 Linux musl 1.2+ x86-64 |
|
SHA-256 checksum How to use checksums |
67d8018d4af4e72650e6c1ea0a90054958c04a3b907c73f1c8e215a74d263c9f
|
|
BLAKE2b-256 checksum How to use checksums |
c23030b6e097c767f53bdc4c5b7ecd7c669930afb643718106b72eb8b926510e
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp313-cp313-musllinux_1_2_aarch64.whl
| Download URL | pyopa-0.9.0-cp313-cp313-musllinux_1_2_aarch64.whl |
|---|---|
| Size | 4.6 MB |
| Tags | CPython 3.13 Linux musl 1.2+ ARM64 |
|
SHA-256 checksum How to use checksums |
93f1b047f5ab455067e2c0eded92c93c0cbb7a9ce6c4deff2b9eec8f74a8c3e8
|
|
BLAKE2b-256 checksum How to use checksums |
e976eee66baaf07ab699a0443bbe4cbe4cb819f54b268288168fbd961e69aee4
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl
| Download URL | pyopa-0.9.0-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl |
|---|---|
| Size | 4.6 MB |
| Tags | CPython 3.13 Linux glibc 2.17+ x86-64 Linux glibc 2.28+ x86-64 |
|
SHA-256 checksum How to use checksums |
b105cff46b336beb885395187eb6cb901b0b8b2f4668335fe0b1e6ab7b0ea953
|
|
BLAKE2b-256 checksum How to use checksums |
85b3fe27ba5a6b37a9221b71f23d4b13393a6a0bfd735e18852866ad2f6bf2af
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl
| Download URL | pyopa-0.9.0-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl |
|---|---|
| Size | 4.6 MB |
| Tags | CPython 3.13 Linux glibc 2.17+ ARM64 Linux glibc 2.28+ ARM64 |
|
SHA-256 checksum How to use checksums |
aa40513bd09291064dc1d3a22f99dc3512fdbd4de3d8b9b5a972c75bde6bfd27
|
|
BLAKE2b-256 checksum How to use checksums |
ffdba718f2b87db2a8cac5b9b433e15f3722178b2614764559f674feb41b3e5a
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp313-cp313-macosx_11_0_x86_64.whl
| Download URL | pyopa-0.9.0-cp313-cp313-macosx_11_0_x86_64.whl |
|---|---|
| Size | 4.0 MB |
| Tags | CPython 3.13 macOS 11.0+ x86-64 |
|
SHA-256 checksum How to use checksums |
19cfdaec250a1e95e59cfcb142ed92b8a5c88010c1c4be92bce2419f2d695447
|
|
BLAKE2b-256 checksum How to use checksums |
5f6ec02ee5b460312ee3781dbbc68c17795e2a5c9b5f8d7c04192933018c2b78
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp313-cp313-macosx_11_0_arm64.whl
| Download URL | pyopa-0.9.0-cp313-cp313-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.9 MB |
| Tags | CPython 3.13 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
75e6f92a3710d85d1e3b5bc0d3efed2fe683d94f24b04874ec40aeca1b22b301
|
|
BLAKE2b-256 checksum How to use checksums |
dd5cc96013b55692a6d0c4bd2a294df3d5efd6e92e54a6d56bffcf7602d69e70
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp312-cp312-win_arm64.whl
| Download URL | pyopa-0.9.0-cp312-cp312-win_arm64.whl |
|---|---|
| Size | 3.8 MB |
| Tags | CPython 3.12 Windows ARM64 |
|
SHA-256 checksum How to use checksums |
66db5b0daaeb8784bac4d549d2b61bde149b45f56f11c8792f9e46a9132012fc
|
|
BLAKE2b-256 checksum How to use checksums |
88096f3b17c3267bd385be234587d2e2a39c801aa576f216439c97bb2cf8e2ae
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp312-cp312-win_amd64.whl
| Download URL | pyopa-0.9.0-cp312-cp312-win_amd64.whl |
|---|---|
| Size | 3.7 MB |
| Tags | CPython 3.12 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
68071d43a6d4579f149974f47fae5163d51999589e2086f1333e10733278db35
|
|
BLAKE2b-256 checksum How to use checksums |
956cbb96bc392f6d76c85e559b4ff5760654224dffa270013e6d5fea3325d41c
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp312-cp312-musllinux_1_2_x86_64.whl
| Download URL | pyopa-0.9.0-cp312-cp312-musllinux_1_2_x86_64.whl |
|---|---|
| Size | 4.6 MB |
| Tags | CPython 3.12 Linux musl 1.2+ x86-64 |
|
SHA-256 checksum How to use checksums |
093b8b0882228cf304339405f23cfe7365d35deacbcfb221d8a4c74ae22e9d78
|
|
BLAKE2b-256 checksum How to use checksums |
c4eb7bb3151be2e342bd46ebb1dc8991dfe96a01e8ceddcfd52d6df4d33266d5
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp312-cp312-musllinux_1_2_aarch64.whl
| Download URL | pyopa-0.9.0-cp312-cp312-musllinux_1_2_aarch64.whl |
|---|---|
| Size | 4.6 MB |
| Tags | CPython 3.12 Linux musl 1.2+ ARM64 |
|
SHA-256 checksum How to use checksums |
69d608faca31df103788efc4056b390691f159940d75cb86a7b104ae167f4709
|
|
BLAKE2b-256 checksum How to use checksums |
19b4e5f959b869ee6244704247086af22002bde8b380a26a0bbf55439a78de97
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl
| Download URL | pyopa-0.9.0-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl |
|---|---|
| Size | 4.6 MB |
| Tags | CPython 3.12 Linux glibc 2.17+ x86-64 Linux glibc 2.28+ x86-64 |
|
SHA-256 checksum How to use checksums |
335b4ea06c5389e463a97c227f8bbe11667324b280549922c77d1bb15f7c7d0d
|
|
BLAKE2b-256 checksum How to use checksums |
45a56a1dbc75eb4badebe52ecf161a215001dd8838d035f84215e7123bcbe8a5
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl
| Download URL | pyopa-0.9.0-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl |
|---|---|
| Size | 4.5 MB |
| Tags | CPython 3.12 Linux glibc 2.17+ ARM64 Linux glibc 2.28+ ARM64 |
|
SHA-256 checksum How to use checksums |
054c05f537f53befe6e69143b219511c6996269ba1d11ef10a53d77895710840
|
|
BLAKE2b-256 checksum How to use checksums |
3704a34860766e11e469c92a860306aeb24ddbc9b8c6cde8291f1719cf39cb29
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp312-cp312-macosx_11_0_x86_64.whl
| Download URL | pyopa-0.9.0-cp312-cp312-macosx_11_0_x86_64.whl |
|---|---|
| Size | 4.0 MB |
| Tags | CPython 3.12 macOS 11.0+ x86-64 |
|
SHA-256 checksum How to use checksums |
4b13ca947693436ee6c10ad0609af0611421eacbdb3970f9419bc51cfc5b045f
|
|
BLAKE2b-256 checksum How to use checksums |
080e899af70378b304a5bed537cabaf146624716f5cd3746de38fa238b55a300
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp312-cp312-macosx_11_0_arm64.whl
| Download URL | pyopa-0.9.0-cp312-cp312-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.9 MB |
| Tags | CPython 3.12 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
9c1c552fb445d7cbdb0b033efd718df252c0b4a772e146301fae8d0c89c2ba77
|
|
BLAKE2b-256 checksum How to use checksums |
03147ae5fbb0a2e97487cd23465fcf8f2e68585a4a11070767155a1c9f2f82f0
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp311-cp311-win_arm64.whl
| Download URL | pyopa-0.9.0-cp311-cp311-win_arm64.whl |
|---|---|
| Size | 3.8 MB |
| Tags | CPython 3.11 Windows ARM64 |
|
SHA-256 checksum How to use checksums |
47b64d81294d546e8e69b5ff5904039dd1d44811cb958f65d76442191d32b3a3
|
|
BLAKE2b-256 checksum How to use checksums |
a87a2afd06463e45452a27e78326a1040f707eade531c4e764c3660ec0d63bf0
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp311-cp311-win_amd64.whl
| Download URL | pyopa-0.9.0-cp311-cp311-win_amd64.whl |
|---|---|
| Size | 3.7 MB |
| Tags | CPython 3.11 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
c54ece0e894f456a22f57b718d497adc01506cd6a9ce467325d6431909cf498d
|
|
BLAKE2b-256 checksum How to use checksums |
1ec304f3b1476ff2f63164375658fc1a70600af491e69c77e93e31b76e07dbbd
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp311-cp311-musllinux_1_2_x86_64.whl
| Download URL | pyopa-0.9.0-cp311-cp311-musllinux_1_2_x86_64.whl |
|---|---|
| Size | 4.5 MB |
| Tags | CPython 3.11 Linux musl 1.2+ x86-64 |
|
SHA-256 checksum How to use checksums |
d739be79fd5f9f376d9a1360acc6af747641c4a98496d65b86fb9efce3f8fff9
|
|
BLAKE2b-256 checksum How to use checksums |
df94cf654205b997edfe8f717323003aa2f3b101f458fca08727a7068b86a4b3
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp311-cp311-musllinux_1_2_aarch64.whl
| Download URL | pyopa-0.9.0-cp311-cp311-musllinux_1_2_aarch64.whl |
|---|---|
| Size | 4.5 MB |
| Tags | CPython 3.11 Linux musl 1.2+ ARM64 |
|
SHA-256 checksum How to use checksums |
f0c62fe88b6e8e22ec7fefda67b4edfe8428a01d4d890b0368f09f266593d1e1
|
|
BLAKE2b-256 checksum How to use checksums |
7a5b4b57a94569fb69a27e4f7d642fd2dffd66b9611bbb58f500844e127e77e9
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl
| Download URL | pyopa-0.9.0-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl |
|---|---|
| Size | 4.5 MB |
| Tags | CPython 3.11 Linux glibc 2.17+ x86-64 Linux glibc 2.28+ x86-64 |
|
SHA-256 checksum How to use checksums |
c0e6768da59995d727059daf6a569e40cd177a43321bd881d2e50676459b1f98
|
|
BLAKE2b-256 checksum How to use checksums |
afb3e29b31d2c0af040de1dc6a1ffd0f160ef104a4450cacb334f35f653d1a24
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl
| Download URL | pyopa-0.9.0-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl |
|---|---|
| Size | 4.5 MB |
| Tags | CPython 3.11 Linux glibc 2.17+ ARM64 Linux glibc 2.28+ ARM64 |
|
SHA-256 checksum How to use checksums |
e3ff2a705816bd299f8475e124d10786a92140333e769c6cf6241a663423e6d9
|
|
BLAKE2b-256 checksum How to use checksums |
9106906f1365469c251c8caa74822e0f97fa457c44b88dcd779c89cb123cda05
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp311-cp311-macosx_11_0_x86_64.whl
| Download URL | pyopa-0.9.0-cp311-cp311-macosx_11_0_x86_64.whl |
|---|---|
| Size | 4.0 MB |
| Tags | CPython 3.11 macOS 11.0+ x86-64 |
|
SHA-256 checksum How to use checksums |
d45006cf437dd49038ad1a59d4d76ebafbba28b5d0cab11b100e2bcb217e5b40
|
|
BLAKE2b-256 checksum How to use checksums |
e0cae790e1f491ee464337d575c8cadccd6e5d2aa1a24f07d66e32c58ceff25b
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp311-cp311-macosx_11_0_arm64.whl
| Download URL | pyopa-0.9.0-cp311-cp311-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.9 MB |
| Tags | CPython 3.11 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
ca3626be5cbf53adcfd6b531ceba66fda109b9c6cfe2b7ef929933a57cad96a9
|
|
BLAKE2b-256 checksum How to use checksums |
99f32f4e5de867d7027b70163c659534565a2a2615df33754d60f198e47543d2
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp310-cp310-win_amd64.whl
| Download URL | pyopa-0.9.0-cp310-cp310-win_amd64.whl |
|---|---|
| Size | 3.7 MB |
| Tags | CPython 3.10 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
71e77b7b7ccb8840e0406925762c6f946bce96854133b23d536bd2577e5a5eda
|
|
BLAKE2b-256 checksum How to use checksums |
655de7a018d18d0ae96c75afdfad01185c2c54512c7843fd335dd44339b10d60
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp310-cp310-musllinux_1_2_x86_64.whl
| Download URL | pyopa-0.9.0-cp310-cp310-musllinux_1_2_x86_64.whl |
|---|---|
| Size | 4.5 MB |
| Tags | CPython 3.10 Linux musl 1.2+ x86-64 |
|
SHA-256 checksum How to use checksums |
5d607f976e8f385603d572e4e73a5556d983b0435b52bf03dad6081f7798cc65
|
|
BLAKE2b-256 checksum How to use checksums |
eb8203a868952b05a31a699a66435c03fec9691f7a5231b40a9083b6d731a30c
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp310-cp310-musllinux_1_2_aarch64.whl
| Download URL | pyopa-0.9.0-cp310-cp310-musllinux_1_2_aarch64.whl |
|---|---|
| Size | 4.4 MB |
| Tags | CPython 3.10 Linux musl 1.2+ ARM64 |
|
SHA-256 checksum How to use checksums |
03d67b40338e239fb9fa490993e31bb52cf6a60f502478b32f5992ca66fb5c32
|
|
BLAKE2b-256 checksum How to use checksums |
678daa2ec412b10d12f509618b8ada0cfe27995756c231cda54366e6cb17a648
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp310-cp310-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl
| Download URL | pyopa-0.9.0-cp310-cp310-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl |
|---|---|
| Size | 4.4 MB |
| Tags | CPython 3.10 Linux glibc 2.17+ x86-64 Linux glibc 2.28+ x86-64 |
|
SHA-256 checksum How to use checksums |
ac51e5076501a37ae55f09255cae7db6c1c1c750cbf4387b484e96e1a4174025
|
|
BLAKE2b-256 checksum How to use checksums |
e0a439c43e9eed57463bcf34fea92e24b641519851517cd109babd649101f688
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp310-cp310-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl
| Download URL | pyopa-0.9.0-cp310-cp310-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl |
|---|---|
| Size | 4.4 MB |
| Tags | CPython 3.10 Linux glibc 2.17+ ARM64 Linux glibc 2.28+ ARM64 |
|
SHA-256 checksum How to use checksums |
bc9ab1ac5021b80b75630dacf7984d4d7dee1ebf837f245f983ea6acf47046a8
|
|
BLAKE2b-256 checksum How to use checksums |
c384ce518f9d3281addaabf6e8d0af4df9b4aff7e146879e669ac96586068cec
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp310-cp310-macosx_11_0_x86_64.whl
| Download URL | pyopa-0.9.0-cp310-cp310-macosx_11_0_x86_64.whl |
|---|---|
| Size | 4.0 MB |
| Tags | CPython 3.10 macOS 11.0+ x86-64 |
|
SHA-256 checksum How to use checksums |
1f442f824b7ecdad948c33640ea60aee7410acecd5e6d28c2ae888f8afd64f5b
|
|
BLAKE2b-256 checksum How to use checksums |
432dd9115609b4b5c479b1966eba5d30217ba8f69d5881d1c5166e349e61c76f
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logRelease files / pyopa-0.9.0-cp310-cp310-macosx_11_0_arm64.whl
| Download URL | pyopa-0.9.0-cp310-cp310-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.9 MB |
| Tags | CPython 3.10 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
9d2e864fbbf6fdde0521e3d59d06bb64c2846a9b9fe40eadea9dd960d5a8c5a7
|
|
BLAKE2b-256 checksum How to use checksums |
3b2573299b2eeba17fe3e78343dc2ea906450664825a6dbfbfde0799aaacc1ce
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/7.0.0 CPython/3.13.16
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logSecurity for pyopa 0.9.0
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
Full provenance
All 48 files in this release have been uploaded with provenance metadata.
Attestation for pyopa-0.9.0.tar.gz
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Oct 30, 2026.
Transparency logA note on package security
PyPI is a repository for distributing packages, not a service for auditing them. While third-party security researchers and our staff do their best to detect and remove malicious packages, PyPI cannot guarantee the quality, security or suitability of any given package.
To learn more about protecting yourself from malicious actors, visit our package security documentation.
