refua 0.0.1

Unified drug discovery ML toolkit

Refua

Refua is a general drug discovery ML toolkit that brings together structure prediction, affinity modeling, and generative design in one package. It unifies the Boltz inference stack with the BoltzGen design pipeline so you can move from target definition to candidate generation using a shared, programmatic API.

Why use Refua?

• Fluent Python API: Build specs, run predictions, and post-process results with a readable, composable API—no need to stitch together CLI calls, YAML, or intermediate files.
• No per-call model reload: Keep a predictor/model instance alive and run many inferences in a loop without paying initialization and checkpoint-loading cost each time.
• All-in-memory workflows: Prepare inputs, run inference, and perform analysis entirely in memory (e.g., passing objects/arrays between steps) without writing temporary files to disk.
• Improved build: We are able to support more up to date dependencies. Over time we expect to widen this support.

Quickstart

Install:

pip install refua

Install with NVIDIA GPU support:

pip install "refua[cuda]"

Boltz-2 API:

from pathlib import Path

from refua import Boltz2

model = Boltz2()

complex_spec = (
    model.fold_complex()
    .protein("A", "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ")
    .ligand("L", "CCO")
)

Path("complex.bcif").write_bytes(complex_spec.to_bcif())
affinity = complex_spec.get_affinity()
print(affinity.ic50, affinity.binding_probability)

BoltzGen API:

from refua import BoltzGen

gen = BoltzGen()
design = (
    gen.design("simple_design")
    .protein("A", "12")
    .total_length(8, 20)
)

features = design.to_features()
print(sorted(features.keys())[:6])

BoltzGen defaults to the bundled molecule library in the Hugging Face cache. Set BOLTZGEN_MOLDIR or pass mol_dir to override.

CLI entrypoints are still available:

boltz --help
boltzgen --help

Documentation

• Boltz docs live in docs/boltz.
• BoltzGen docs live in docs/boltzgen.
• API reference source lives in docs/api (build with sphinx-build -b html docs/api docs/api/_build/html).

Examples

• examples/antibody_design.py shows a minimal BoltzGen antibody design spec.
• examples/protein_ligand_affinity.py shows a Boltz protein-ligand affinity spec.
• examples/boltz2_kras_mrtx1133.py folds KRAS G12D with the MRTX-1133 inhibitor and prints affinity.
• examples/boltzgen_peptide_binder.py shows a BoltzGen peptide binder spec with optional cyclic peptides.
• examples/boltz_constraints.py shows a Boltz complex with pocket/contact constraints and an optional MSA.
• examples/boltz_multichain_msa.py shows multi-chain MSAs with cross-chain constraints.
• examples/boltzgen_template_insertions.py shows template structure groups and design insertions.
• examples/boltz_multi_pocket_complex.py shows multi-ligand pocket constraints with contacts.
• examples/boltzgen_template_masks.py shows template masks with design/not-design ranges and structure groups.

Notes

This repository consolidates the two stacks into a single build and dependency set. If you need the legacy standalone documentation, it has been preserved under docs/.