Unified drug discovery ML toolkit
Project description
Refua
Refua is a general drug discovery ML toolkit that brings together structure prediction, affinity modeling, and generative design in one package. It unifies the Boltz inference stack with the BoltzGen design pipeline so you can move from target definition to candidate generation using a shared, programmatic API.
Why use Refua?
- Fluent Python API: Build specs, run predictions, and post-process results with a readable, composable API—no need to stitch together CLI calls, YAML, or intermediate files.
- No per-call model reload: Keep a predictor/model instance alive and run many inferences in a loop without paying initialization and checkpoint-loading cost each time.
- All-in-memory workflows: Prepare inputs, run inference, and perform analysis entirely in memory (e.g., passing objects/arrays between steps) without writing temporary files to disk.
- Improved build: We are able to support more up to date dependencies. Over time we expect to widen this support.
Quickstart
Install:
pip install refua
Install with NVIDIA GPU support:
pip install "refua[cuda]"
Boltz-2 API:
from pathlib import Path
from refua import Boltz2
model = Boltz2()
complex_spec = (
model.fold_complex()
.protein("A", "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ")
.ligand("L", "CCO")
)
Path("complex.bcif").write_bytes(complex_spec.to_bcif())
affinity = complex_spec.get_affinity()
print(affinity.ic50, affinity.binding_probability)
BoltzGen API:
from refua import BoltzGen
gen = BoltzGen()
design = (
gen.design("simple_design")
.protein("A", "12")
.total_length(8, 20)
)
features = design.to_features()
print(sorted(features.keys())[:6])
Small molecule properties:
from refua import SM
props = SM("CCO", lazy=True)
print(props.mol_wt(), props.logp())
print(props.to_dict())
Pass lazy=False to compute all properties eagerly.
BoltzGen defaults to the bundled molecule library in the Hugging Face cache. Set BOLTZGEN_MOLDIR or pass mol_dir to override.
CLI entrypoints are still available:
boltz --help
boltzgen --help
Documentation
- Boltz docs live in
docs/boltz. - BoltzGen docs live in
docs/boltzgen. - API reference source lives in
docs/api(build withsphinx-build -b html docs/api docs/api/_build/html).
Examples
examples/antibody_design.pyshows a minimal BoltzGen antibody design spec.examples/protein_ligand_affinity.pyshows a Boltz protein-ligand affinity spec.examples/boltz2_kras_mrtx1133.pyfolds KRAS G12D with the MRTX-1133 inhibitor and prints affinity.examples/boltzgen_peptide_binder.pyshows a BoltzGen peptide binder spec with optional cyclic peptides.examples/boltz_constraints.pyshows a Boltz complex with pocket/contact constraints and an optional MSA.examples/boltz_multichain_msa.pyshows multi-chain MSAs with cross-chain constraints.examples/boltzgen_template_insertions.pyshows template structure groups and design insertions.examples/boltz_multi_pocket_complex.pyshows multi-ligand pocket constraints with contacts.examples/boltzgen_template_masks.pyshows template masks with design/not-design ranges and structure groups.
Notes
This repository consolidates the two stacks into a single build and dependency set. If you need the legacy standalone documentation, it has been preserved under docs/.
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file refua-0.1.0.tar.gz.
File metadata
- Download URL: refua-0.1.0.tar.gz
- Upload date:
- Size: 508.4 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: poetry/2.2.1 CPython/3.14.2 Darwin/25.2.0
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
a4199f1f8b0b6f9ec044fff38e0f3871e23ee25fe032a6add1acb6e4b0497304
|
|
| MD5 |
9b6a00c2d0fd45bf43032d7eb0433e58
|
|
| BLAKE2b-256 |
c7888f12e8db0f506f93f34179e7099db6a839e1ccfbbd9ff6b7acf56e541faf
|
File details
Details for the file refua-0.1.0-py3-none-any.whl.
File metadata
- Download URL: refua-0.1.0-py3-none-any.whl
- Upload date:
- Size: 641.7 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: poetry/2.2.1 CPython/3.14.2 Darwin/25.2.0
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
8fbf3dfc59cb491a24d0c233770dce7a1fb70aae00a7598fb7e51a7d7e822fcf
|
|
| MD5 |
4c0866d72fcf365a28617bab61bec78a
|
|
| BLAKE2b-256 |
438884287ad1be8e1ea6649149f638a8f26a58b85fc516985fef1f90bd733753
|