Skip to main content

Unified drug discovery ML toolkit

Project description

Refua

Refua is a general drug discovery ML toolkit that brings together structure prediction, affinity modeling, and generative design in one package. It unifies the Boltz inference stack with the BoltzGen design pipeline so you can move from target definition to candidate generation using a shared, programmatic API.

Why use Refua?

  • Fluent Python API: Build specs, run predictions, and post-process results with a readable, composable API—no need to stitch together CLI calls, YAML, or intermediate files.
  • No per-call model reload: Keep a predictor/model instance alive and run many inferences in a loop without paying initialization and checkpoint-loading cost each time.
  • All-in-memory workflows: Prepare inputs, run inference, and perform analysis entirely in memory (e.g., passing objects/arrays between steps) without writing temporary files to disk.
  • Improved build: We are able to support more up to date dependencies. Over time we expect to widen this support.

Quickstart

Install:

pip install refua

Install with NVIDIA GPU support:

pip install "refua[cuda]"

Unified API (same Complex flow for ligands or binders):

from pathlib import Path

from refua import Binder, Complex, Protein, SM

target = Protein(
    "MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQQLAGKYTPEEIRNVLSTLQKAD",
    ids="A",
)

# Protein + ligand -> Boltz2 structure + affinity
result = (
    Complex([target, SM("Cn1cnc2n(C)c(=O)n(C)c(=O)c12")], name="demo")
    .request_affinity()
    .fold()
)
Path("complex.bcif").write_bytes(result.to_bcif())
print(result.affinity.ic50, result.affinity.binding_probability)

# Protein + binder placeholder -> Boltz2 structure + BoltzGen design inputs
binder = Binder(length=12, ids="P")
result = Complex([target, binder], name="design").fold()
Path("design.bcif").write_bytes(result.to_bcif())
print("binder spec:", binder.sequence)

For template-based designs, add .file(...) to the same Complex before fold().

Small molecule properties:

from refua import SM

props = SM("Cn1cnc2n(C)c(=O)n(C)c(=O)c12", lazy=True)
print(props.mol_wt(), props.logp())
print(props.to_dict())

Pass lazy=False to compute all properties eagerly.

Model-based ADMET predictions (optional; requires refua[admet]):

props = SM("Cn1cnc2n(C)c(=O)n(C)c(=O)c12")
profile = props.admet_profile()
print(profile["admet_score"], profile["assessment"])
print(props.herg(), props.ames())

BoltzGen defaults to the bundled molecule library in the Hugging Face cache. Set BOLTZGEN_MOLDIR or pass mol_dir to override.

CLI entrypoints are still available:

boltz --help
boltzgen --help

Documentation

  • Boltz docs live in docs/boltz.
  • BoltzGen docs live in docs/boltzgen.
  • API reference source lives in docs/api (build with sphinx-build -b html docs/api docs/api/_build/html).

Examples

  • examples/antibody_design.py shows a minimal antibody design spec with template targets.
  • examples/protein_ligand_affinity.py shows a protein-ligand affinity spec.
  • examples/boltz2_kras_mrtx1133.py folds KRAS G12D with the MRTX-1133 inhibitor and prints affinity.
  • examples/boltzgen_peptide_binder.py shows a peptide binder spec with optional cyclic peptides.
  • examples/boltz_constraints.py shows a complex with pocket/contact constraints and an optional MSA.
  • examples/boltz_multichain_msa.py shows multi-chain MSAs with cross-chain constraints.
  • examples/boltzgen_template_insertions.py shows template structure groups and design insertions.
  • examples/boltz_multi_pocket_complex.py shows multi-ligand pocket constraints with contacts.
  • examples/boltzgen_template_masks.py shows template masks with design/not-design ranges and structure groups.

Notes

This repository consolidates the two stacks into a single build and dependency set. If you need the legacy standalone documentation, it has been preserved under docs/.

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

refua-0.4.0.tar.gz (524.9 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

refua-0.4.0-py3-none-any.whl (658.9 kB view details)

Uploaded Python 3

File details

Details for the file refua-0.4.0.tar.gz.

File metadata

  • Download URL: refua-0.4.0.tar.gz
  • Upload date:
  • Size: 524.9 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: poetry/2.3.1 CPython/3.14.2 Darwin/25.2.0

File hashes

Hashes for refua-0.4.0.tar.gz
Algorithm Hash digest
SHA256 3318f7371b0019e9d378b2a895f7e82d2170698d17659750d3a5daf7d35a6fb4
MD5 39f528f1b9c8b2ea118246c36c5ac100
BLAKE2b-256 ed701bfeffb44fac789bba162e261787cb8d92bf262a9289a54f28f20c77d246

See more details on using hashes here.

File details

Details for the file refua-0.4.0-py3-none-any.whl.

File metadata

  • Download URL: refua-0.4.0-py3-none-any.whl
  • Upload date:
  • Size: 658.9 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: poetry/2.3.1 CPython/3.14.2 Darwin/25.2.0

File hashes

Hashes for refua-0.4.0-py3-none-any.whl
Algorithm Hash digest
SHA256 f542338e7c68bb19bcda2109229e191490802b5d09dbc40c0acc68c29d4af563
MD5 06fc01466468a5b99833ed1a3a9fcc9d
BLAKE2b-256 e000ab7a1ca3937b8bdc93f306f674b144c8a87f7e5f18caca6bbb5ea6dcd69f

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page