Variant annotation in Python
Project description
Varcode
Varcode is a library for working with genomic variant data in Python and predicting the impact of those variants on protein sequences.
Installation
You can install varcode using pip:
pip install varcode
You can install required reference genome data through PyEnsembl as follows:
# Downloads and installs the Ensembl releases (75 and 76)
pyensembl install --release 75 76
Example
import varcode
# Load TCGA MAF containing variants from their
variants = varcode.load_maf("tcga-ovarian-cancer-variants.maf")
print(variants)
### <VariantCollection from 'tcga-ovarian-cancer-variants.maf' with 6428 elements>
### -- Variant(contig=1, start=69538, ref=G, alt=A, genome=GRCh37)
### -- Variant(contig=1, start=881892, ref=T, alt=G, genome=GRCh37)
### -- Variant(contig=1, start=3389714, ref=G, alt=A, genome=GRCh37)
### -- Variant(contig=1, start=3624325, ref=G, alt=T, genome=GRCh37)
### ...
# you can index into a VariantCollection and get back a Variant object
variant = variants[0]
# groupby_gene_name returns a dictionary whose keys are gene names
# and whose values are themselves VariantCollections
gene_groups = variants.groupby_gene_name()
# get variants which affect the TP53 gene
TP53_variants = gene_groups["TP53"]
# predict protein coding effect of every TP53 variant on
# each transcript of the TP53 gene
TP53_effects = TP53_variants.effects()
print(TP53_effects)
### <EffectCollection with 789 elements>
### -- PrematureStop(variant=chr17 g.7574003G>A, transcript_name=TP53-001, transcript_id=ENST00000269305, effect_description=p.R342*)
### -- ThreePrimeUTR(variant=chr17 g.7574003G>A, transcript_name=TP53-005, transcript_id=ENST00000420246)
### -- PrematureStop(variant=chr17 g.7574003G>A, transcript_name=TP53-002, transcript_id=ENST00000445888, effect_description=p.R342*)
### -- FrameShift(variant=chr17 g.7574030_7574030delG, transcript_name=TP53-001, transcript_id=ENST00000269305, effect_description=p.R333fs)
### ...
premature_stop_effect = TP53_effects[0]
print(str(premature_stop_effect.mutant_protein_sequence))
### 'MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMF'
print(premature_stop_effect.aa_mutation_start_offset)
### 341
print(premature_stop_effect.transcript)
### Transcript(id=ENST00000269305, name=TP53-001, gene_name=TP53, biotype=protein_coding, location=17:7571720-7590856)
print(premature_stop_effect.gene.name)
### 'TP53'
If you are looking for a quick start guide, you can check out this iPython book that demonstrates simple use cases of Varcode.
Further reading
Feature guides live in docs/:
- Genotypes and sample-aware queries — per-sample
zygosity on multi-sample VCFs (
Genotype,Zygosity,VariantCollection.for_sample,.heterozygous_in,.homozygous_alt_in). New in 2.3. - CSV round-trip and metadata headers —
to_csv/from_csvon both collection types, with#-prefixed provenance headers. New in 2.1, refined in 2.2. - Error handling —
ReferenceMismatchError,SampleNotFoundError, and theraise_on_error=Falseescape hatch.
See CHANGELOG.md for the release history.
Effect Types
| Effect type | Description |
|---|---|
| AlternateStartCodon | Replace annotated start codon with alternative start codon (e.g. "ATG>CAG"). |
| ComplexSubstitution | Insertion and deletion of multiple amino acids. |
| Deletion | Coding mutation which causes deletion of amino acid(s). |
| ExonLoss | Deletion of entire exon, significantly disrupts protein. |
| ExonicSpliceSite | Mutation at the beginning or end of an exon, may affect splicing. |
| FivePrimeUTR | Variant affects 5' untranslated region before start codon. |
| FrameShiftTruncation | A frameshift which leads immediately to a stop codon (no novel amino acids created). |
| FrameShift | Out-of-frame insertion or deletion of nucleotides, causes novel protein sequence and often premature stop codon. |
| IncompleteTranscript | Can't determine effect since transcript annotation is incomplete (often missing either the start or stop codon). |
| Insertion | Coding mutation which causes insertion of amino acid(s). |
| Intergenic | Occurs outside of any annotated gene. |
| Intragenic | Within the annotated boundaries of a gene but not in a region that's transcribed into pre-mRNA. |
| IntronicSpliceSite | Mutation near the beginning or end of an intron but less likely to affect splicing than donor/acceptor mutations. |
| Intronic | Variant occurs between exons and is unlikely to affect splicing. |
| NoncodingTranscript | Transcript doesn't code for a protein. |
| PrematureStop | Insertion of stop codon, truncates protein. |
| Silent | Mutation in coding sequence which does not change the amino acid sequence of the translated protein. |
| SpliceAcceptor | Mutation in the last two nucleotides of an intron, likely to affect splicing. |
| SpliceDonor | Mutation in the first two nucleotides of an intron, likely to affect splicing. |
| StartLoss | Mutation causes loss of start codon, likely result is that an alternate start codon will be used down-stream (possibly in a different frame). |
| StopLoss | Loss of stop codon, causes extension of protein by translation of nucleotides from 3' UTR. |
| Substitution | Coding mutation which causes simple substitution of one amino acid for another. |
| ThreePrimeUTR | Variant affects 3' untranslated region after stop codon of mRNA. |
Coordinate System
Varcode currently uses a "base counted, one start" genomic coordinate system, to match the Ensembl annotation database. We are planning to switch over to "space counted, zero start" (interbase) coordinates, since that system allows for more uniform logic (no special cases for insertions). To learn more about genomic coordinate systems, read this blog post.
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file varcode-2.11.0.tar.gz.
File metadata
- Download URL: varcode-2.11.0.tar.gz
- Upload date:
- Size: 163.2 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/6.2.0 CPython/3.12.6
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
447ae091eb9b7421e5f82c879f91554189be159e3fe446105297a3726749e438
|
|
| MD5 |
abcc827aa410a3ed017504603e9dd5e0
|
|
| BLAKE2b-256 |
b086bf083b3e94cbe05e1fe63d3023a9a4efbfa3bd5c542df38339d7c729d3cd
|
File details
Details for the file varcode-2.11.0-py3-none-any.whl.
File metadata
- Download URL: varcode-2.11.0-py3-none-any.whl
- Upload date:
- Size: 126.7 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/6.2.0 CPython/3.12.6
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
64c4194ef7aaf033a34be54d7a32d8f698a5f9af9ffa71cac74283ea8d1e758c
|
|
| MD5 |
0ae157269188b047cf0184d89c8793f4
|
|
| BLAKE2b-256 |
229e3892c4a0756ec87cf463471519230c80513e681d9df40767a164601fbad3
|