mhcflurry
MHC I ligand prediction package with competitive accuracy and a fast and documented implementation.
[!IMPORTANT] Version 2.2.0 is the first release to use PyTorch as its neural network backend, replacing TensorFlow/Keras used in previous versions. It loads the same published weights and produces equivalent predictions, so existing workflows should continue to work with no changes.
Key changes in 2.2.0:
- Backend: TensorFlow/Keras replaced by PyTorch (>= 2.0)
- Python: Requires Python 3.10+ (previously 3.9+)
- Dependencies:
pandas >= 2.0is now required;tensorflowandkerasare no longer needed- Hardware: Automatic GPU detection; Apple Silicon (MPS) is now supported
If you are upgrading from 2.1.x, simply
pip install --upgrade mhcflurry. The published pre-trained models are unchanged and will be loaded and converted automatically.
MHCflurry implements class I peptide/MHC binding affinity prediction. The current version provides pan-MHC I predictors supporting any MHC allele of known sequence. MHCflurry runs on Python 3.10+ using the PyTorch neural network library. It exposes command-line and Python library interfaces.
MHCflurry also includes two experimental predictors, an "antigen processing" predictor that attempts to model MHC allele-independent effects such as proteosomal cleavage and a "presentation" predictor that integrates processing predictions with binding affinity predictions to give a composite "presentation score." Both models are trained on mass spec-identified MHC ligands.
If you find MHCflurry useful in your research please cite:
T. O'Donnell, A. Rubinsteyn, U. Laserson. "MHCflurry 2.0: Improved pan-allele prediction of MHC I-presented peptides by incorporating antigen processing," Cell Systems, 2020. https://doi.org/10.1016/j.cels.2020.06.010
T. O'Donnell, A. Rubinsteyn, M. Bonsack, A. B. Riemer, U. Laserson, and J. Hammerbacher, "MHCflurry: Open-Source Class I MHC Binding Affinity Prediction," Cell Systems, 2018. https://doi.org/10.1016/j.cels.2018.05.014
Please file an issue if you have questions or encounter problems.
Have a bugfix or other contribution? We would love your help. See our contributing guidelines.
Try it now
You can generate MHCflurry predictions without any setup by running our Google colaboratory notebook.
Installation (pip)
Install the package:
$ pip install mhcflurry
Download our datasets and trained models:
$ mhcflurry-downloads fetch
You can now generate predictions:
$ mhcflurry-predict \
--alleles HLA-A0201 HLA-A0301 \
--peptides SIINFEKL SIINFEKD SIINFEKQ \
--out /tmp/predictions.csv
Wrote: /tmp/predictions.csv
Or scan protein sequences for potential epitopes:
$ mhcflurry-predict-scan \
--sequences MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS \
--alleles HLA-A*02:01 \
--out /tmp/predictions.csv
Wrote: /tmp/predictions.csv
See the documentation for more details.
Docker
You can also try the latest (GitHub master) version of MHCflurry using the Docker image hosted on Dockerhub by running:
$ docker run -p 9999:9999 --rm openvax/mhcflurry:latest
This will start a jupyter notebook server in an
environment that has MHCflurry installed. Go to http://localhost:9999 in a
browser to use it.
To build the Docker image yourself, from a checkout run:
$ docker build -t mhcflurry:latest .
$ docker run -p 9999:9999 --rm mhcflurry:latest
Predicted sequence motifs
Sequence logos for the binding motifs learned by MHCflurry BA are available here.
Common issues and fixes
Problems downloading data and models
Some users have reported HTTP connection issues when using mhcflurry-downloads fetch. As a workaround, you can download the data manually (e.g. using wget) and then use mhcflurry-downloads just to copy the data to the right place.
To do this, first get the URL(s) of the downloads you need using mhcflurry-downloads url:
$ mhcflurry-downloads url models_class1_presentation
https://github.com/openvax/mhcflurry/releases/download/1.6.0/models_class1_presentation.20200205.tar.bz2```
Then make a directory and download the needed files to this directory:
$ mkdir downloads
$ wget --directory-prefix downloads https://github.com/openvax/mhcflurry/releases/download/1.6.0/models_class1_presentation.20200205.tar.bz2```
HTTP request sent, awaiting response... 200 OK
Length: 72616448 (69M) [application/octet-stream]
Saving to: 'downloads/models_class1_presentation.20200205.tar.bz2'
Now call mhcflurry-downloads fetch with the --already-downloaded-dir option to indicate that the downloads should be retrived from the specified directory:
$ mhcflurry-downloads fetch models_class1_presentation --already-downloaded-dir downloads
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file mhcflurry-2.2.1.tar.gz.
File metadata
- Download URL: mhcflurry-2.2.1.tar.gz
- Upload date:
- Size: 178.4 kB
- Tags: Source
- Uploaded using Trusted Publishing? Yes
- Uploaded via:
twine/6.1.0 CPython/3.13.12
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
cda123729b649e94e1da9af40cdedf2d6823f39ebfd87dd36e47eb994bb3c4a0
|
|
| MD5 |
144498d8f9ab43bde815cb6baa116f72
|
|
| BLAKE2b-256 |
dd7f9001cdc0a1dabfa9dac11a53520eb84f1f6b1167c49390bf332864367dcf
|
Provenance
The following attestation bundles were made for mhcflurry-2.2.1.tar.gz:
Publisher:
release.yml on openvax/mhcflurry
-
Statement:
-
Statement type:
https://in-toto.io/Statement/v1 -
Predicate type:
https://docs.pypi.org/attestations/publish/v1 -
Subject name:
mhcflurry-2.2.1.tar.gz -
Subject digest:
cda123729b649e94e1da9af40cdedf2d6823f39ebfd87dd36e47eb994bb3c4a0 - Sigstore transparency entry: 1339675648
- Sigstore integration time:
-
Permalink:
openvax/mhcflurry@6afbf04312b247d4c1e46dc14902d20faa92e893 -
Branch / Tag:
refs/tags/v2.2.1 - Owner: https://github.com/openvax
-
Access:
public
-
Token Issuer:
https://token.actions.githubusercontent.com -
Runner Environment:
github-hosted -
Publication workflow:
release.yml@6afbf04312b247d4c1e46dc14902d20faa92e893 -
Trigger Event:
release
-
Statement type:
File details
Details for the file mhcflurry-2.2.1-py3-none-any.whl.
File metadata
- Download URL: mhcflurry-2.2.1-py3-none-any.whl
- Upload date:
- Size: 157.0 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? Yes
- Uploaded via:
twine/6.1.0 CPython/3.13.12
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
cd934e9b092de76e477442c6f84aab1265def91acfa5ae129308116dbfa66ac7
|
|
| MD5 |
5f3b515a8055a6ab017ea3faa1e984df
|
|
| BLAKE2b-256 |
9ef7a465e7fef6c06fb649f5334550a73b4db5f387e7dbd3517a778d1c3fe923
|
Provenance
The following attestation bundles were made for mhcflurry-2.2.1-py3-none-any.whl:
Publisher:
release.yml on openvax/mhcflurry
-
Statement:
-
Statement type:
https://in-toto.io/Statement/v1 -
Predicate type:
https://docs.pypi.org/attestations/publish/v1 -
Subject name:
mhcflurry-2.2.1-py3-none-any.whl -
Subject digest:
cd934e9b092de76e477442c6f84aab1265def91acfa5ae129308116dbfa66ac7 - Sigstore transparency entry: 1339675669
- Sigstore integration time:
-
Permalink:
openvax/mhcflurry@6afbf04312b247d4c1e46dc14902d20faa92e893 -
Branch / Tag:
refs/tags/v2.2.1 - Owner: https://github.com/openvax
-
Access:
public
-
Token Issuer:
https://token.actions.githubusercontent.com -
Runner Environment:
github-hosted -
Publication workflow:
release.yml@6afbf04312b247d4c1e46dc14902d20faa92e893 -
Trigger Event:
release
-
Statement type: